Recombinant Human MAP1LC3A protein, GST-tagged
Cat.No. : | MAP1LC3A-301446H |
Product Overview : | Recombinant Human MAP1LC3A (1-121 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Phe121 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | MAP1LC3A microtubule-associated protein 1 light chain 3 alpha [ Homo sapiens ] |
Official Symbol | MAP1LC3A |
Synonyms | MAP1LC3A; microtubule-associated protein 1 light chain 3 alpha; ATG8E; LC3; LC3A; MAP1ALC3; MAP1BLC3; |
Gene ID | 8199 |
MIM | 601242 |
UniProt ID | Q9H492 |
◆ Recombinant Proteins | ||
MAP1LC3A-5695P | Recombinant Portunus trituberculatus MAP1LC3A Protein (Full Length), N-His tagged | +Inquiry |
MAP1LC3A-5322M | Recombinant Mouse MAP1LC3A Protein, His (Fc)-Avi-tagged | +Inquiry |
MAP1LC3A-297H | Recombinant Human MAP1LC3A protein, His/MBP-tagged | +Inquiry |
MAP1LC3A-784H | Active Recombinant Human MAP1LC3A Protein, His-tagged | +Inquiry |
MAP1LC3A-2660R | Recombinant Rhesus monkey MAP1LC3A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP1LC3A-4514HCL | Recombinant Human MAP1LC3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP1LC3A Products
Required fields are marked with *
My Review for All MAP1LC3A Products
Required fields are marked with *