Recombinant Human MAP1LC3A protein, GST-tagged

Cat.No. : MAP1LC3A-301446H
Product Overview : Recombinant Human MAP1LC3A (1-121 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Phe121
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name MAP1LC3A microtubule-associated protein 1 light chain 3 alpha [ Homo sapiens ]
Official Symbol MAP1LC3A
Synonyms MAP1LC3A; microtubule-associated protein 1 light chain 3 alpha; ATG8E; LC3; LC3A; MAP1ALC3; MAP1BLC3;
Gene ID 8199
MIM 601242
UniProt ID Q9H492

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAP1LC3A Products

Required fields are marked with *

My Review for All MAP1LC3A Products

Required fields are marked with *

0
cart-icon