Recombinant Human MAP1LC3B
Cat.No. : | MAP1LC3B-29219TH |
Product Overview : | Recombinant full length Human LC3B expressed in Saccharomyces cerevisiae; 125 amino acids, MWt 14.7 kDa. The protein contains a tag, increasing its size to 40 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Description : | The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKG EKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQA FFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQ ETFGMKLSV |
Full Length : | Full L. |
Gene Name | MAP1LC3B microtubule-associated protein 1 light chain 3 beta [ Homo sapiens ] |
Official Symbol | MAP1LC3B |
Synonyms | MAP1LC3B; microtubule-associated protein 1 light chain 3 beta; microtubule-associated proteins 1A/1B light chain 3B; ATG8F; |
Gene ID | 81631 |
mRNA Refseq | NM_022818 |
Protein Refseq | NP_073729 |
MIM | 609604 |
Uniprot ID | Q9GZQ8 |
Chromosome Location | 16q24.2 |
Pathway | Senescence and Autophagy, organism-specific biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
MAP1LC3B-192H | Active Recombinant Human MAP1LC3B, His-tagged | +Inquiry |
MAP1LC3B-7477H | Recombinant Human MAP1LC3B protein | +Inquiry |
MAP1LC3B-298H | Recombinant Human MAP1LC3B protein, His/MBP-tagged | +Inquiry |
MAP1LC3B-3214R | Recombinant Rat MAP1LC3B Protein, His (Fc)-Avi-tagged | +Inquiry |
MAP1LC3B-2433H | Recombinant Human MAP1LC3B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP1LC3B-4513HCL | Recombinant Human MAP1LC3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAP1LC3B Products
Required fields are marked with *
My Review for All MAP1LC3B Products
Required fields are marked with *
0
Inquiry Basket