Recombinant Human MAP1LC3B
Cat.No. : | MAP1LC3B-29219TH |
Product Overview : | Recombinant full length Human LC3B expressed in Saccharomyces cerevisiae; 125 amino acids, MWt 14.7 kDa. The protein contains a tag, increasing its size to 40 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKG EKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQA FFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQ ETFGMKLSV |
Gene Name : | MAP1LC3B microtubule-associated protein 1 light chain 3 beta [ Homo sapiens ] |
Official Symbol : | MAP1LC3B |
Synonyms : | MAP1LC3B; microtubule-associated protein 1 light chain 3 beta; microtubule-associated proteins 1A/1B light chain 3B; ATG8F; |
Gene ID : | 81631 |
mRNA Refseq : | NM_022818 |
Protein Refseq : | NP_073729 |
MIM : | 609604 |
Uniprot ID : | Q9GZQ8 |
Chromosome Location : | 16q24.2 |
Pathway : | Senescence and Autophagy, organism-specific biosystem; |
Function : | protein binding; |
Products Types
◆ Recombinant Protein | ||
Map1lc3b-221M | Recombinant Mouse Map1lc3b Protein, His-tagged | +Inquiry |
MAP1LC3B-5323M | Recombinant Mouse MAP1LC3B Protein, His (Fc)-Avi-tagged | +Inquiry |
MAP1LC3B-3214R | Recombinant Rat MAP1LC3B Protein, His (Fc)-Avi-tagged | +Inquiry |
MAP1LC3B-2412H | Recombinant Human MAP1LC3B Protein, His-tagged | +Inquiry |
MAP1LC3B-2481R | Recombinant Rhesus Macaque MAP1LC3B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
MAP1LC3B-4513HCL | Recombinant Human MAP1LC3B 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Ask a Question for All MAP1LC3B Products
Required fields are marked with *
My Review for All MAP1LC3B Products
Required fields are marked with *
0
Inquiry Basket