Recombinant Human MAP2K3 protein, His-SUMO-tagged

Cat.No. : MAP2K3-3202H
Product Overview : Recombinant Human MAP2K3 protein(P46734)(1-347aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-347aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 55.3 kDa
AA Sequence : MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name MAP2K3 mitogen-activated protein kinase kinase 3 [ Homo sapiens ]
Official Symbol MAP2K3
Synonyms MAP2K3; mitogen-activated protein kinase kinase 3; PRKMK3; dual specificity mitogen-activated protein kinase kinase 3; dual specificity mitogen activated protein kinase kinase 3; MAP kinase kinase 3; MAPK/ERK kinase 3; MAPKK3; MEK3; MKK3; MEK 3; MAPKK 3; SAPK kinase 2; stress-activated protein kinase kinase 2; SAPKK2; SAPKK-2;
Gene ID 5606
mRNA Refseq NM_002756
Protein Refseq NP_002747
MIM 602315
UniProt ID P46734

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAP2K3 Products

Required fields are marked with *

My Review for All MAP2K3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon