Recombinant Human MAP2K3 protein, MBP&His-Avi-tagged, Biotinylated
| Cat.No. : | MAP2K3-785H |
| Product Overview : | Biotinylated Recombinant Human MAP2K3 protein(P46734)(1-347aa), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Avi&His&MBP |
| Protein Length : | 1-347a.a. |
| Tag : | MBP&His&Avi |
| Conjugation/Label : | Biotin |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 87.1 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS |
| Conjugation : | Biotin |
| Gene Name | MAP2K3 mitogen-activated protein kinase kinase 3 [ Homo sapiens ] |
| Official Symbol | MAP2K3 |
| Synonyms | MAP2K3; mitogen-activated protein kinase kinase 3; PRKMK3; dual specificity mitogen-activated protein kinase kinase 3; dual specificity mitogen activated protein kinase kinase 3; MAP kinase kinase 3; MAPK/ERK kinase 3; MAPKK3; MEK3; MKK3; MEK 3; MAPKK 3; SAPK kinase 2; stress-activated protein kinase kinase 2; SAPKK2; SAPKK-2; |
| Gene ID | 5606 |
| mRNA Refseq | NM_002756 |
| Protein Refseq | NP_002747 |
| MIM | 602315 |
| UniProt ID | P46734 |
| ◆ Recombinant Proteins | ||
| MAP2K3-14HFL | Unactive Recombinant Full Length Human MS4A1 Protein, N-GST tagged | +Inquiry |
| MAP2K3-2664R | Recombinant Rhesus monkey MAP2K3 Protein, His-tagged | +Inquiry |
| MAP2K3-15HFL | Active Recombinant Full Length Human MS4A1 Protein, N-GST tagged | +Inquiry |
| MAP2K3-303H | Recombinant Human MAP2K3 protein, His/MBP-tagged | +Inquiry |
| MAP2K3-20HFL | Recombinant Human MAP2K3 Protein, Full Length, C-Flag tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MAP2K3-4510HCL | Recombinant Human MAP2K3 293 Cell Lysate | +Inquiry |
| MAP2K3-234HKCL | Human MAP2K3 Knockdown Cell Lysate | +Inquiry |
| MAP2K3-4511HCL | Recombinant Human MAP2K3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP2K3 Products
Required fields are marked with *
My Review for All MAP2K3 Products
Required fields are marked with *
