Recombinant Human MAP2K5
Cat.No. : | MAP2K5-29560TH |
Product Overview : | Recombinant full length Human MEK5 with N terminal proprietary tag; predicted MWt 75.02 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically interacts with and activates MAPK7/ERK5. This kinase itself can be phosphorylated and activated by MAP3K3/MEKK3, as well as by atypical protein kinase C isoforms (aPKCs). The signal cascade mediated by this kinase is involved in growth factor stimulated cell proliferation and muscle cell differentiation. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been described. |
Protein length : | 448 amino acids |
Molecular Weight : | 75.020kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed in many adult tissues. Abundant in heart and skeletal muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLL FRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKA MLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL KVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQ MNEQDIRYRDTLGHGNGGTVYKAYHVPSGKILAVKVILLD ITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC TEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKIL HRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTN AYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ KNQGSLMPLQLLQCIVDEDSPVLPVGESSEPFVHFITQCM RKQPKERPAPEELMGHPFIVQFNDGNAAVVSMWVCRALEE RRSQQGPP |
Sequence Similarities : | Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.Contains 1 OPR domain.Contains 1 protein kinase domain. |
Gene Name : | MAP2K5 mitogen-activated protein kinase kinase 5 [ Homo sapiens ] |
Official Symbol : | MAP2K5 |
Synonyms : | MAP2K5; mitogen-activated protein kinase kinase 5; PRKMK5; dual specificity mitogen-activated protein kinase kinase 5; HsT17454; MAPKK5; MEK5; |
Gene ID : | 5607 |
mRNA Refseq : | NM_001206804 |
Protein Refseq : | NP_001193733 |
MIM : | 602520 |
Uniprot ID : | Q13163 |
Chromosome Location : | 15q22.31 |
Pathway : | EGFR1 Signaling Pathway, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Gap junction, organism-specific biosystem; Gap junction, conserved biosystem; |
Function : | ATP binding; MAP kinase activity; metal ion binding; nucleotide binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
MAP2K5-003H | Recombinant Human MAP2K5 Protein, GST-tagged | +Inquiry |
MAP2K5-001H | Recombinant Human MAP2K5 Protein, GST-tagged | +Inquiry |
MAP2K5-422C | Recombinant Cynomolgus Monkey MAP2K5 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAP2K5-5325M | Recombinant Mouse MAP2K5 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAP2K5-3431H | Recombinant Human MAP2K5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
MAP2K5-4509HCL | Recombinant Human MAP2K5 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All MAP2K5 Products
Required fields are marked with *
My Review for All MAP2K5 Products
Required fields are marked with *
0
Inquiry Basket