Recombinant Human MAP2K6 protein, His-tagged
Cat.No. : | MAP2K6-3059H |
Product Overview : | Recombinant Human MAP2K6 protein(1-334 aa), fused to His tag, was expressed in E. coli. |
Availability | June 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-334 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MAP2K6 mitogen-activated protein kinase kinase 6 [ Homo sapiens ] |
Official Symbol | MAP2K6 |
Synonyms | MAP2K6; mitogen-activated protein kinase kinase 6; PRKMK6; dual specificity mitogen-activated protein kinase kinase 6; MAPKK6; MEK6; MKK6; protein kinase; mitogen activated; kinase 6 (MAP kinase kinase 6); SAPKK3; MEK 6; MAPKK 6; SAPK kinase 3; MAPK/ERK kinase 6; stress-activated protein kinase kinase 3; protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6); SAPKK-3; |
Gene ID | 5608 |
mRNA Refseq | NM_002758 |
Protein Refseq | NP_002749 |
MIM | 601254 |
UniProt ID | P52564 |
◆ Recombinant Proteins | ||
MAP2K6-97H | Recombinant Human MAP2K6, His-tagged | +Inquiry |
MAP2K6-440HFL | Active Recombinant Full Length Human MAP2K6 Protein, C-Flag-tagged | +Inquiry |
MAP2K6-888H | Active Recombinant Human MAP2K6 protein, His&GST-tagged | +Inquiry |
MKK6-2193H | Recombinant Human MKK6 protein | +Inquiry |
MAP2K6-889H | Active Recombinant Human MAP2K6 protein (Met 1-Asp 334 (Ser 207/Asp, Thr 211/Asp)), His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP2K6-001HCL | Recombinant Human MAP2K6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP2K6 Products
Required fields are marked with *
My Review for All MAP2K6 Products
Required fields are marked with *