Recombinant Human MAP3K13 protein, GST-tagged
Cat.No. : | MAP3K13-3713H |
Product Overview : | Recombinant Human MAP3K13 protein(706 - 839 aa), fused to GST tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 706 - 839 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | DCWRSSEPDKGQAGPWGCCQADAYDPCLQCRPEQYGSLDIPSAEPVGRSPDLSKSPAHNPLLENAQSSEKTEENEFSGCRSESSLGTSHLGTPPALPRKTRPLQKSGDDSSEEEEGEVDSEVEFPRRQRPHRCI |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MAP3K13 mitogen-activated protein kinase kinase kinase 13 [ Homo sapiens ] |
Official Symbol | MAP3K13 |
Synonyms | MAP3K13; mitogen-activated protein kinase kinase kinase 13; leucine zipper bearing kinase; LZK; MEKK13; mixed lineage kinase; leucine zipper-bearing kinase; MLK; MGC133196; |
Gene ID | 9175 |
mRNA Refseq | NM_001242314 |
Protein Refseq | NP_001229243 |
MIM | 604915 |
UniProt ID | O43283 |
◆ Recombinant Proteins | ||
MAP3K13-5330M | Recombinant Mouse MAP3K13 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAP3K13-1940HF | Active Recombinant Full Length Human MAP3K13 Protein, GST-tagged | +Inquiry |
MAP3K13-9509M | Recombinant Mouse MAP3K13 Protein | +Inquiry |
MAP3K13-3713H | Recombinant Human MAP3K13 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP3K13-1055HCL | Recombinant Human MAP3K13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAP3K13 Products
Required fields are marked with *
My Review for All MAP3K13 Products
Required fields are marked with *
0
Inquiry Basket