Recombinant Human MAP3K14 protein, His&Myc-tagged

• Cat.No.: MAP3K14-4382H
• Product Overview: Recombinant Human MAP3K14 protein(Q99558)(400-655aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 400-655aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 35.4 kDa
• AA Sequence: ATHQLRLGRGSFGEVHRMEDKQTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLVKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVCLQPDGLGKSLLTGDYIPGTETHMAPEVVLGRSCDAKVDVWSSCCMMLHMLNGCHPWTQFFRGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRVSAAELGGKVNRAL
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: MAP3K14 mitogen-activated protein kinase kinase kinase 14 [ Homo sapiens ]
• Official Symbol: MAP3K14
• Synonyms: MAP3K14; mitogen-activated protein kinase kinase kinase 14; FTDCR1B; HS; HSNIK; NIK; serine/threonine protein kinase; NF-kappa-beta-inducing kinase; serine/threonine protein-kinase; serine/threonine-protein kinase NIK
• Gene ID: 9020
• mRNA Refseq: NM_003954
• Protein Refseq: NP_003945
• MIM: 604655
• UniProt ID: Q99558