Recombinant Human MAP3K14 protein, His&Myc-tagged
Cat.No. : | MAP3K14-4382H |
Product Overview : | Recombinant Human MAP3K14 protein(Q99558)(400-655aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 400-655aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.4 kDa |
AA Sequence : | ATHQLRLGRGSFGEVHRMEDKQTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLVKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVCLQPDGLGKSLLTGDYIPGTETHMAPEVVLGRSCDAKVDVWSSCCMMLHMLNGCHPWTQFFRGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRVSAAELGGKVNRAL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | MAP3K14 mitogen-activated protein kinase kinase kinase 14 [ Homo sapiens ] |
Official Symbol | MAP3K14 |
Synonyms | MAP3K14; mitogen-activated protein kinase kinase kinase 14; FTDCR1B; HS; HSNIK; NIK; serine/threonine protein kinase; NF-kappa-beta-inducing kinase; serine/threonine protein-kinase; serine/threonine-protein kinase NIK; |
Gene ID | 9020 |
mRNA Refseq | NM_003954 |
Protein Refseq | NP_003945 |
MIM | 604655 |
UniProt ID | Q99558 |
◆ Recombinant Proteins | ||
MAP3K14-4382H | Recombinant Human MAP3K14 protein, His&Myc-tagged | +Inquiry |
MAP3K14-2668R | Recombinant Rhesus monkey MAP3K14 Protein, His-tagged | +Inquiry |
MAP3K14-0626H | Recombinant Human MAP3K14 Protein (L318-P947), Tag Free | +Inquiry |
MAP3K14-2677H | Recombinant Human MAP3K14 protein, His-tagged | +Inquiry |
MAP3K14-01H | Active Recombinant Human MAP3K14 Protein, GST&His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP3K14-4507HCL | Recombinant Human MAP3K14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP3K14 Products
Required fields are marked with *
My Review for All MAP3K14 Products
Required fields are marked with *