Recombinant Human MAP3K14 protein, His&Myc-tagged
| Cat.No. : | MAP3K14-4382H |
| Product Overview : | Recombinant Human MAP3K14 protein(Q99558)(400-655aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 400-655aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 35.4 kDa |
| AA Sequence : | ATHQLRLGRGSFGEVHRMEDKQTGFQCAVKKVRLEVFRAEELMACAGLTSPRIVPLYGAVREGPWVNIFMELLEGGSLGQLVKEQGCLPEDRALYYLGQALEGLEYLHSRRILHGDVKADNVLLSSDGSHAALCDFGHAVCLQPDGLGKSLLTGDYIPGTETHMAPEVVLGRSCDAKVDVWSSCCMMLHMLNGCHPWTQFFRGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPIHRVSAAELGGKVNRAL |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | MAP3K14 mitogen-activated protein kinase kinase kinase 14 [ Homo sapiens ] |
| Official Symbol | MAP3K14 |
| Synonyms | MAP3K14; mitogen-activated protein kinase kinase kinase 14; FTDCR1B; HS; HSNIK; NIK; serine/threonine protein kinase; NF-kappa-beta-inducing kinase; serine/threonine protein-kinase; serine/threonine-protein kinase NIK; |
| Gene ID | 9020 |
| mRNA Refseq | NM_003954 |
| Protein Refseq | NP_003945 |
| MIM | 604655 |
| UniProt ID | Q99558 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP3K14 Products
Required fields are marked with *
My Review for All MAP3K14 Products
Required fields are marked with *



