Recombinant Human MAP3K5 protein, GST-tagged
Cat.No. : | MAP3K5-7846H |
Product Overview : | Recombinant Human MAP3K5 protein(1180-1374 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1180-1374 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | LASESDTADQEDLDVEDDHEEQPSNQTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | MAP3K5 mitogen-activated protein kinase kinase kinase 5 [ Homo sapiens ] |
Official Symbol | MAP3K5 |
Synonyms | MAP3K5; mitogen-activated protein kinase kinase kinase 5; MEKK5; apoptosis signal regulating kinase 1; ASK1; MAPKKK5; ASK-1; MEKK 5; MEK kinase 5; MAP/ERK kinase kinase 5; MAPK/ERK kinase kinase 5; apoptosis signal-regulating kinase 1; |
Gene ID | 4217 |
mRNA Refseq | NM_005923 |
Protein Refseq | NP_005914 |
MIM | 602448 |
UniProt ID | Q99683 |
◆ Recombinant Proteins | ||
MAP3K5-7528Z | Recombinant Zebrafish MAP3K5 | +Inquiry |
Map3k5-3931M | Recombinant Mouse Map3k5 Protein, Myc/DDK-tagged | +Inquiry |
MAP3K5-1260H | Recombinant Human Mitogen-Activated Protein Kinase Kinase Kinase 5, GST-tagged | +Inquiry |
MAP3K5-245H | Recombinant Human MAP3K5, GST-tagged, Active | +Inquiry |
MAP3K5-7845H | Recombinant Human MAP3K5 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP3K5-4504HCL | Recombinant Human MAP3K5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP3K5 Products
Required fields are marked with *
My Review for All MAP3K5 Products
Required fields are marked with *