Recombinant Human MAP3K5 protein, GST-tagged

• Cat.No.: MAP3K5-7846H
• Product Overview: Recombinant Human MAP3K5 protein(1180-1374 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1180-1374 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: LASESDTADQEDLDVEDDHEEQPSNQTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: MAP3K5 mitogen-activated protein kinase kinase kinase 5 [ Homo sapiens ]
• Official Symbol: MAP3K5
• Synonyms: MAP3K5; mitogen-activated protein kinase kinase kinase 5; MEKK5; apoptosis signal regulating kinase 1; ASK1; MAPKKK5; ASK-1; MEKK 5; MEK kinase 5; MAP/ERK kinase kinase 5; MAPK/ERK kinase kinase 5; apoptosis signal-regulating kinase 1
• Gene ID: 4217
• mRNA Refseq: NM_005923
• Protein Refseq: NP_005914
• MIM: 602448
• UniProt ID: Q99683