Recombinant Human MAP3K5 protein, GST-tagged
| Cat.No. : | MAP3K5-7846H |
| Product Overview : | Recombinant Human MAP3K5 protein(1180-1374 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1180-1374 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | LASESDTADQEDLDVEDDHEEQPSNQTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | MAP3K5 mitogen-activated protein kinase kinase kinase 5 [ Homo sapiens ] |
| Official Symbol | MAP3K5 |
| Synonyms | MAP3K5; mitogen-activated protein kinase kinase kinase 5; MEKK5; apoptosis signal regulating kinase 1; ASK1; MAPKKK5; ASK-1; MEKK 5; MEK kinase 5; MAP/ERK kinase kinase 5; MAPK/ERK kinase kinase 5; apoptosis signal-regulating kinase 1; |
| Gene ID | 4217 |
| mRNA Refseq | NM_005923 |
| Protein Refseq | NP_005914 |
| MIM | 602448 |
| UniProt ID | Q99683 |
| ◆ Recombinant Proteins | ||
| ASK1-3585M | Recombinant Mouse ASK1, His-tagged, T7 tagged | +Inquiry |
| MAP3K5-5333M | Recombinant Mouse MAP3K5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Map3k5-3931M | Recombinant Mouse Map3k5 Protein, Myc/DDK-tagged | +Inquiry |
| MAP3K5-26518TH | Recombinant Human MAP3K5 | +Inquiry |
| MAP3K5-1260H | Recombinant Human Mitogen-Activated Protein Kinase Kinase Kinase 5, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MAP3K5-4504HCL | Recombinant Human MAP3K5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP3K5 Products
Required fields are marked with *
My Review for All MAP3K5 Products
Required fields are marked with *
