Recombinant Human MAP4

• Cat.No.: MAP4-29752TH
• Product Overview: Recombinant full length Human MAP4 (aa 1-99) with N-terminal proprietary tag, 36.96 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 99 amino acids
• Description: The protein encoded by this gene is a major non-neuronal microtubule-associated protein. This protein contains a domain similar to the microtubule-binding domains of neuronal microtubule-associated protein (MAP2) and microtubule-associated protein tau (MAPT/TAU). This protein promotes microtubule assembly, and has been shown to counteract destabilization of interphase microtubule catastrophe promotion. Cyclin B was found to interact with this protein, which targets cell division cycle 2 (CDC2) kinase to microtubules. The phosphorylation of this protein affects microtubule properties and cell cycle progression. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 36.960kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGNSESKKKPCSETSQIEDTPSSKPTLLANGGHGVEGSDTTEA
• Sequence Similarities: Contains 4 Tau/MAP repeats.

Gene Information

• Gene Name: MAP4 microtubule-associated protein 4 [ Homo sapiens ]
• Official Symbol: MAP4
• Synonyms: MAP4; microtubule-associated protein 4
• Gene ID: 4134
• mRNA Refseq: NM_001134364
• Protein Refseq: NP_001127836
• MIM: 157132
• Uniprot ID: P27816
• Chromosome Location: 3p21
• Function: protein binding; structural molecule activity