Recombinant Human MAP4K3 protein, His-tagged

Cat.No. : MAP4K3-7319H
Product Overview : Recombinant Human MAP4K3 protein(345-515 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 345-515 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : ETEPHHELDLQLEYGQGHQGGYFLGANKSLLKSVEEELHQRGHVAHLEDDEGDDDESKHSTLKAKIPPPLPPKPKSIFIPQEMHSTEDENQGTIKRCPMSGSPAKPSQVPPRPPPPRLPPHKPVALGNGMSSFQLNGERDGSLCQQQNEHRGTNLSRKEKKDVPKPISNGL
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 [ Homo sapiens ]
Official Symbol MAP4K3
Synonyms MAP4K3; mitogen-activated protein kinase kinase kinase kinase 3; RAB8IPL1; GLK; MAPKKKK3; MEK kinase kinase 3; MAPK/ERK kinase kinase kinase 3; germinal center kinase-like kinase; germinal center kinase-related protein kinase; MEKKK 3;
Gene ID 8491
mRNA Refseq NM_003618
Protein Refseq NP_003609
MIM 604921
UniProt ID Q8IVH8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAP4K3 Products

Required fields are marked with *

My Review for All MAP4K3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon