Recombinant Human MAP4K3 protein, His-tagged

• Cat.No.: MAP4K3-7319H
• Product Overview: Recombinant Human MAP4K3 protein(345-515 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 345-515 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: ETEPHHELDLQLEYGQGHQGGYFLGANKSLLKSVEEELHQRGHVAHLEDDEGDDDESKHSTLKAKIPPPLPPKPKSIFIPQEMHSTEDENQGTIKRCPMSGSPAKPSQVPPRPPPPRLPPHKPVALGNGMSSFQLNGERDGSLCQQQNEHRGTNLSRKEKKDVPKPISNGL
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 [ Homo sapiens ]
• Official Symbol: MAP4K3
• Synonyms: MAP4K3; mitogen-activated protein kinase kinase kinase kinase 3; RAB8IPL1; GLK; MAPKKKK3; MEK kinase kinase 3; MAPK/ERK kinase kinase kinase 3; germinal center kinase-like kinase; germinal center kinase-related protein kinase; MEKKK 3
• Gene ID: 8491
• mRNA Refseq: NM_003618
• Protein Refseq: NP_003609
• MIM: 604921
• UniProt ID: Q8IVH8