Recombinant Human MAPK10 protein, His-tagged
Cat.No. : | MAPK10-2784H |
Product Overview : | Recombinant Human MAPK10 protein(271-408 aa), fused to His tag, was expressed in E. coli. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 271-408 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MAPK10 mitogen-activated protein kinase 10 [ Homo sapiens ] |
Official Symbol | MAPK10 |
Synonyms | MAPK10; mitogen-activated protein kinase 10; PRKM10; JNK3; p54bSAPK; p493F12; MAPK 10; MAP kinase 10; MAP kinase p49 3F12; JNK3 alpha protein kinase; c-Jun N-terminal kinase 3; stress-activated protein kinase 1b; stress activated protein kinase beta; stress-activated protein kinase JNK3; JNK3A; SAPK1b; FLJ12099; FLJ33785; MGC50974; |
Gene ID | 5602 |
mRNA Refseq | NM_002753 |
Protein Refseq | NP_002744 |
MIM | 602897 |
UniProt ID | P53779 |
◆ Recombinant Proteins | ||
MAPK10-752H | Recombinant Human Mitogen-activated Protein Kinase 10 | +Inquiry |
MAPK10-87HFL | Unactive Recombinant Full Length Human MAPK10 Protein, N-His-tagged | +Inquiry |
MAPK10-27605TH | Recombinant Human MAPK10 | +Inquiry |
MAPK10-339H | Recombinant Human MAPK10, GST-tagged, Active | +Inquiry |
MAPK10-01H | Recombinant Human MAPK10 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPK10-4498HCL | Recombinant Human MAPK10 293 Cell Lysate | +Inquiry |
MAPK10-4499HCL | Recombinant Human MAPK10 293 Cell Lysate | +Inquiry |
MAPK10-4497HCL | Recombinant Human MAPK10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAPK10 Products
Required fields are marked with *
My Review for All MAPK10 Products
Required fields are marked with *
0
Inquiry Basket