Recombinant Human MAPK12 protein, GST-tagged
| Cat.No. : | MAPK12-3014H |
| Product Overview : | Recombinant Human MAPK12 (216-349 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met216-Leu349 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MAPK12 mitogen-activated protein kinase 12 [ Homo sapiens ] |
| Official Symbol | MAPK12 |
| Synonyms | MAPK12; mitogen-activated protein kinase 12; SAPK3; ERK6; p38gamma; PRKM12; SAPK 3; ERK-6; MAPK 12; MAP kinase 12; MAP kinase p38 gamma; stress-activated protein kinase 3; mitogen-activated protein kinase 3; extracellular signal-regulated kinase 6; mitogen-activated protein kinase p38 gamma; ERK3; SAPK-3; P38GAMMA; |
| Gene ID | 6300 |
| mRNA Refseq | NM_002969 |
| Protein Refseq | NP_002960 |
| MIM | 602399 |
| UniProt ID | P53778 |
| ◆ Recombinant Proteins | ||
| MAPK12-738H | Recombinant Human Mitogen-activated Protein Kinase 12 | +Inquiry |
| MAPK12-9248HF | Active Recombinant Full Length Human MAPK12 Protein, GST-tagged | +Inquiry |
| MAPK12-5345M | Recombinant Mouse MAPK12 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MAPK12-1340H | Recombinant Human MAPK12 protein, His-tagged | +Inquiry |
| MAPK12-169H | Recombinant Human MAPK12 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MAPK12-001HCL | Recombinant Human MAPK12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAPK12 Products
Required fields are marked with *
My Review for All MAPK12 Products
Required fields are marked with *
