Recombinant Human MAPK13 protein, His-SUMO-tagged

Cat.No. : MAPK13-3205H
Product Overview : Recombinant Human MAPK13 protein(O15264)(1-365aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-365aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 58.1 kDa
AA Sequence : MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name MAPK13 mitogen-activated protein kinase 13 [ Homo sapiens ]
Official Symbol MAPK13
Synonyms MAPK13; mitogen-activated protein kinase 13; PRKM13; p38delta; SAPK4; MAPK 13; MAP kinase 13; MAP kinase p38 delta; stress-activated protein kinase 4; mitogen-activated protein kinase p38 delta; MGC99536;
Gene ID 5603
mRNA Refseq NM_002754
Protein Refseq NP_002745
MIM 602899
UniProt ID O15264

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAPK13 Products

Required fields are marked with *

My Review for All MAPK13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon