Recombinant Human MAPK7
Cat.No. : | MAPK7-26231TH |
Product Overview : | Recombinant fragment corresponding to amino acids 561-677 of Human ERK5 with an N terminal proprietary tag; Predicted MWt 38.5 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 561-677 a.a. |
Description : | The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is specifically activated by mitogen-activated protein kinase kinase 5 (MAP2K5/MEK5). It is involved in the downstream signaling processes of various receptor molecules including receptor type kinases, and G protein-coupled receptors. In response to extracelluar signals, this kinase translocates to cell nucleus, where it regulates gene expression by phosphorylating, and activating different transcription factors. Four alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported. |
Molecular Weight : | 38.500kDa inclusive of tags |
Tissue specificity : | Expressed in many adult tissues. Abundant in heart, placenta, lung, kidney and skeletal muscle. Not detectable in liver. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PQSSMSESPDVNLVTQQLSKSQVEDPLPPVFSGTPKGSGA GYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLA DWLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP |
Sequence Similarities : | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.Contains 1 protein kinase domain. |
Gene Name | MAPK7 mitogen-activated protein kinase 7 [ Homo sapiens ] |
Official Symbol | MAPK7 |
Synonyms | MAPK7; mitogen-activated protein kinase 7; PRKM7; BMK1; BMK1 kinase; ERK5; extracellular signal regulated kinase 5; |
Gene ID | 5598 |
mRNA Refseq | NM_002749 |
Protein Refseq | NP_002740 |
MIM | 602521 |
Uniprot ID | Q13164 |
Chromosome Location | 17p11.2 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; ERK/MAPK targets, organism-specific biosystem; ERKs are inactivated, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; |
Function | ATP binding; MAP kinase activity; nucleotide binding; protein binding; protein serine/threonine kinase activity; |
◆ Recombinant Proteins | ||
Mapk7-6950M | Recombinant Mouse Mapk7 protein, His & T7-tagged | +Inquiry |
MAPK7-283H | Recombinant Human MAPK7 protein, His/MBP-tagged | +Inquiry |
MAPK7-846H | Recombinant Human MAPK7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MAPK7-2141Z | Recombinant Zebrafish MAPK7 | +Inquiry |
MAPK7-6949H | Recombinant Human MAPK7 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPK7-4491HCL | Recombinant Human MAPK7 293 Cell Lysate | +Inquiry |
MAPK7-4490HCL | Recombinant Human MAPK7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAPK7 Products
Required fields are marked with *
My Review for All MAPK7 Products
Required fields are marked with *
0
Inquiry Basket