Recombinant Human MAPK7

Cat.No. : MAPK7-26231TH
Product Overview : Recombinant fragment corresponding to amino acids 561-677 of Human ERK5 with an N terminal proprietary tag; Predicted MWt 38.5 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 561-677 a.a.
Description : The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is specifically activated by mitogen-activated protein kinase kinase 5 (MAP2K5/MEK5). It is involved in the downstream signaling processes of various receptor molecules including receptor type kinases, and G protein-coupled receptors. In response to extracelluar signals, this kinase translocates to cell nucleus, where it regulates gene expression by phosphorylating, and activating different transcription factors. Four alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported.
Molecular Weight : 38.500kDa inclusive of tags
Tissue specificity : Expressed in many adult tissues. Abundant in heart, placenta, lung, kidney and skeletal muscle. Not detectable in liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PQSSMSESPDVNLVTQQLSKSQVEDPLPPVFSGTPKGSGA GYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLA DWLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP
Sequence Similarities : Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.Contains 1 protein kinase domain.
Gene Name MAPK7 mitogen-activated protein kinase 7 [ Homo sapiens ]
Official Symbol MAPK7
Synonyms MAPK7; mitogen-activated protein kinase 7; PRKM7; BMK1; BMK1 kinase; ERK5; extracellular signal regulated kinase 5;
Gene ID 5598
mRNA Refseq NM_002749
Protein Refseq NP_002740
MIM 602521
Uniprot ID Q13164
Chromosome Location 17p11.2
Pathway Activated TLR4 signalling, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; ERK/MAPK targets, organism-specific biosystem; ERKs are inactivated, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem;
Function ATP binding; MAP kinase activity; nucleotide binding; protein binding; protein serine/threonine kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAPK7 Products

Required fields are marked with *

My Review for All MAPK7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon