Recombinant Human MAPRE1, His-tagged

Cat.No. : MAPRE1-29128TH
Product Overview : Recombinant full length Human MAPRE1 with an N terminal His tag; 288 amino acids with tag, Predicted MWt 32.2kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 268 amino acids
Description : The protein encoded by this gene was first identified by its binding to the APC protein which is often mutated in familial and sporadic forms of colorectal cancer. This protein localizes to microtubules, especially the growing ends, in interphase cells. During mitosis, the protein is associated with the centrosomes and spindle microtubules. The protein also associates with components of the dynactin complex and the intermediate chain of cytoplasmic dynein. Because of these associations, it is thought that this protein is involved in the regulation of microtubule structures and chromosome stability. This gene is a member of the RP/EB family.
Conjugation : HIS
Molecular Weight : 32.200kDa inclusive of tags
Tissue specificity : Ubiquitously expressed.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY
Sequence Similarities : Belongs to the MAPRE family.Contains 1 CH (calponin-homology) domain.Contains 1 EB1 C-terminal domain.
Gene Name MAPRE1 microtubule-associated protein, RP/EB family, member 1 [ Homo sapiens ]
Official Symbol MAPRE1
Synonyms MAPRE1; microtubule-associated protein, RP/EB family, member 1; microtubule-associated protein RP/EB family member 1; adenomatous polyposis coli binding protein EB1; EB1;
Gene ID 22919
mRNA Refseq NM_012325
Protein Refseq NP_036457
MIM 603108
Uniprot ID Q15691
Chromosome Location 20q11.1-q11.3
Pathway Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; DNA Replication, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Loss of Nlp from mitotic centrosomes, organism-specific biosystem;
Function microtubule plus-end binding; protein C-terminus binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAPRE1 Products

Required fields are marked with *

My Review for All MAPRE1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon