Recombinant Human MAPRE1, His-tagged
Cat.No. : | MAPRE1-29128TH |
Product Overview : | Recombinant full length Human MAPRE1 with an N terminal His tag; 288 amino acids with tag, Predicted MWt 32.2kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 268 amino acids |
Description : | The protein encoded by this gene was first identified by its binding to the APC protein which is often mutated in familial and sporadic forms of colorectal cancer. This protein localizes to microtubules, especially the growing ends, in interphase cells. During mitosis, the protein is associated with the centrosomes and spindle microtubules. The protein also associates with components of the dynactin complex and the intermediate chain of cytoplasmic dynein. Because of these associations, it is thought that this protein is involved in the regulation of microtubule structures and chromosome stability. This gene is a member of the RP/EB family. |
Conjugation : | HIS |
Molecular Weight : | 32.200kDa inclusive of tags |
Tissue specificity : | Ubiquitously expressed. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY |
Sequence Similarities : | Belongs to the MAPRE family.Contains 1 CH (calponin-homology) domain.Contains 1 EB1 C-terminal domain. |
Gene Name | MAPRE1 microtubule-associated protein, RP/EB family, member 1 [ Homo sapiens ] |
Official Symbol | MAPRE1 |
Synonyms | MAPRE1; microtubule-associated protein, RP/EB family, member 1; microtubule-associated protein RP/EB family member 1; adenomatous polyposis coli binding protein EB1; EB1; |
Gene ID | 22919 |
mRNA Refseq | NM_012325 |
Protein Refseq | NP_036457 |
MIM | 603108 |
Uniprot ID | Q15691 |
Chromosome Location | 20q11.1-q11.3 |
Pathway | Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; DNA Replication, organism-specific biosystem; G2/M Transition, organism-specific biosystem; Loss of Nlp from mitotic centrosomes, organism-specific biosystem; |
Function | microtubule plus-end binding; protein C-terminus binding; protein binding; |
◆ Recombinant Proteins | ||
MAPRE1-6355H | Recombinant Human MAPRE1 protein, His-tagged | +Inquiry |
MAPRE1-2677R | Recombinant Rhesus monkey MAPRE1 Protein, His-tagged | +Inquiry |
MAPRE1-1486HFL | Recombinant Full Length Human MAPRE1 Protein, C-Flag-tagged | +Inquiry |
MAPRE1-1368H | Recombinant Human MAPRE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAPRE1-2554C | Recombinant Chicken MAPRE1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPRE1-4481HCL | Recombinant Human MAPRE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAPRE1 Products
Required fields are marked with *
My Review for All MAPRE1 Products
Required fields are marked with *