Recombinant Human MAPRE2, His-tagged
Cat.No. : | MAPRE2-27378TH |
Product Overview : | Recombinant full-length Human EB2 with a N terminal His tag. 347 amino acids with a predicted MWt 39.2 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 327 amino acids |
Description : | The protein encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. The function of this protein is unknown; however, its homology suggests involvement in tumorigenesis of colorectal cancers and proliferative control of normal cells. This gene may belong to the intermediate/early gene family, involved in the signal transduction cascade downstream of the TCR. Alternative splicing results in multiple transcript variants. |
Conjugation : | HIS |
Molecular Weight : | 39.200kDa inclusive of tags |
Tissue specificity : | Expressed in different tumor cell lines. Up-regulated in activated B- and T-lymphocytes. |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY |
Sequence Similarities : | Belongs to the MAPRE family.Contains 1 CH (calponin-homology) domain.Contains 1 EB1 C-terminal domain. |
Gene Name | MAPRE2 microtubule-associated protein, RP/EB family, member 2 [ Homo sapiens ] |
Official Symbol | MAPRE2 |
Synonyms | MAPRE2; microtubule-associated protein, RP/EB family, member 2; microtubule-associated protein RP/EB family member 2; APC binding protein EB1; EB1; EB2; RP1; |
Gene ID | 10982 |
mRNA Refseq | NM_001143826 |
Protein Refseq | NP_001137298 |
MIM | 605789 |
Uniprot ID | Q15555 |
Chromosome Location | 18q12.1 |
Function | microtubule binding; |
◆ Recombinant Proteins | ||
MAPRE2-748H | Recombinant Human MAPRE2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MAPRE2-6047Z | Recombinant Zebrafish MAPRE2 | +Inquiry |
MAPRE2-3580R | Recombinant Rat MAPRE2 Protein | +Inquiry |
MAPRE2-27378TH | Recombinant Human MAPRE2, His-tagged | +Inquiry |
MAPRE2-9549M | Recombinant Mouse MAPRE2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPRE2-4480HCL | Recombinant Human MAPRE2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAPRE2 Products
Required fields are marked with *
My Review for All MAPRE2 Products
Required fields are marked with *
0
Inquiry Basket