Recombinant Human MAPRE2, His-tagged

• Cat.No.: MAPRE2-27378TH
• Product Overview: Recombinant full-length Human EB2 with a N terminal His tag. 347 amino acids with a predicted MWt 39.2 kDa including tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 327 amino acids
• Description: The protein encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. The function of this protein is unknown; however, its homology suggests involvement in tumorigenesis of colorectal cancers and proliferative control of normal cells. This gene may belong to the intermediate/early gene family, involved in the signal transduction cascade downstream of the TCR. Alternative splicing results in multiple transcript variants.
• Conjugation: HIS
• Molecular Weight: 39.200kDa inclusive of tags
• Tissue specificity: Expressed in different tumor cell lines. Up-regulated in activated B- and T-lymphocytes.
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY
• Sequence Similarities: Belongs to the MAPRE family.Contains 1 CH (calponin-homology) domain.Contains 1 EB1 C-terminal domain.

Gene Information

• Gene Name: MAPRE2 microtubule-associated protein, RP/EB family, member 2 [ Homo sapiens ]
• Official Symbol: MAPRE2
• Synonyms: MAPRE2; microtubule-associated protein, RP/EB family, member 2; microtubule-associated protein RP/EB family member 2; APC binding protein EB1; EB1; EB2; RP1
• Gene ID: 10982
• mRNA Refseq: NM_001143826
• Protein Refseq: NP_001137298
• MIM: 605789
• Uniprot ID: Q15555
• Chromosome Location: 18q12.1
• Function: microtubule binding