Recombinant Human MAPRE2, His-tagged

Cat.No. : MAPRE2-27378TH
Product Overview : Recombinant full-length Human EB2 with a N terminal His tag. 347 amino acids with a predicted MWt 39.2 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 327 amino acids
Description : The protein encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. The function of this protein is unknown; however, its homology suggests involvement in tumorigenesis of colorectal cancers and proliferative control of normal cells. This gene may belong to the intermediate/early gene family, involved in the signal transduction cascade downstream of the TCR. Alternative splicing results in multiple transcript variants.
Conjugation : HIS
Molecular Weight : 39.200kDa inclusive of tags
Tissue specificity : Expressed in different tumor cell lines. Up-regulated in activated B- and T-lymphocytes.
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY
Sequence Similarities : Belongs to the MAPRE family.Contains 1 CH (calponin-homology) domain.Contains 1 EB1 C-terminal domain.
Gene Name MAPRE2 microtubule-associated protein, RP/EB family, member 2 [ Homo sapiens ]
Official Symbol MAPRE2
Synonyms MAPRE2; microtubule-associated protein, RP/EB family, member 2; microtubule-associated protein RP/EB family member 2; APC binding protein EB1; EB1; EB2; RP1;
Gene ID 10982
mRNA Refseq NM_001143826
Protein Refseq NP_001137298
MIM 605789
Uniprot ID Q15555
Chromosome Location 18q12.1
Function microtubule binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAPRE2 Products

Required fields are marked with *

My Review for All MAPRE2 Products

Required fields are marked with *

0
cart-icon
0
compare icon