Recombinant Human MAPRE2 protein, GST-tagged
Cat.No. : | MAPRE2-1788H |
Product Overview : | Recombinant Human MAPRE2 protein(6-327 aa), fused to GST tag, was expressed in E. coli. |
Availability | September 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 6-327 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | QTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MAPRE2 microtubule-associated protein, RP/EB family, member 2 [ Homo sapiens ] |
Official Symbol | MAPRE2 |
Synonyms | MAPRE2; microtubule-associated protein, RP/EB family, member 2; microtubule-associated protein RP/EB family member 2; APC binding protein EB1; EB1; EB2; RP1; end-binding protein 2; APC-binding protein EB1; APC-binding protein EB2; T-cell activation protein, EB1 family; |
Gene ID | 10982 |
mRNA Refseq | NM_001143826 |
Protein Refseq | NP_001137298 |
MIM | 605789 |
UniProt ID | Q15555 |
◆ Recombinant Proteins | ||
MAPRE2-1788H | Recombinant Human MAPRE2 protein, GST-tagged | +Inquiry |
Mapre2-3952M | Recombinant Mouse Mapre2 Protein, Myc/DDK-tagged | +Inquiry |
MAPRE2-5360M | Recombinant Mouse MAPRE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAPRE2-2498R | Recombinant Rhesus Macaque MAPRE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAPRE2-2678R | Recombinant Rhesus monkey MAPRE2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPRE2-4480HCL | Recombinant Human MAPRE2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAPRE2 Products
Required fields are marked with *
My Review for All MAPRE2 Products
Required fields are marked with *