Recombinant Human MARCKS protein, GST-tagged
Cat.No. : | MARCKS-17H |
Product Overview : | Recombinant Human MARCKS(2 a.a. - 65 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 2-65 a.a. |
Description : | The protein encoded by this gene is a substrate for protein kinase C. It is localized to the plasma membrane and is an actin filament crosslinking protein. Phosphorylation by protein kinase C or binding to calcium-calmodulin inhibits its association with actin and with the plasma membrane, leading to its presence in the cytoplasm. The protein is thought to be involved in cell motility, phagocytosis, membrane trafficking and mitogenesis. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 32.78 kDa |
AA Sequence : | GAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | MARCKS myristoylated alanine-rich protein kinase C substrate [ Homo sapiens ] |
Official Symbol | MARCKS |
Synonyms | MARCKS; myristoylated alanine-rich protein kinase C substrate; MACS, myristoylated alanine rich protein kinase C substrate (MARCKS, 80K L); myristoylated alanine-rich C-kinase substrate; 80K L; PKCSL; phosphomyristin; protein kinase C substrate, 80 kDa protein, light chain; myristoylated alanine-rich protein kinase C substrate (MARCKS, 80K-L); MACS; 80K-L; PRKCSL; FLJ14368; FLJ90045; |
Gene ID | 4082 |
mRNA Refseq | NM_002356 |
Protein Refseq | NP_002347 |
MIM | 177061 |
UniProt ID | P29966 |
Chromosome Location | 6q21 |
Pathway | Fc gamma R-mediated phagocytosis, organism-specific biosystem; Fc gamma R-mediated phagocytosis, conserved biosystem; Integration of energy metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Regulation of Insulin Secretion, organism-specific biosystem; Regulation of Insulin Secretion by Acetylcholine, organism-specific biosystem; |
Function | actin filament binding; calmodulin binding; protein kinase C binding; |
◆ Recombinant Proteins | ||
MARCKS-5370M | Recombinant Mouse MARCKS Protein, His (Fc)-Avi-tagged | +Inquiry |
MARCKS-7029C | Recombinant Chicken MARCKS | +Inquiry |
MARCKS-5590HFL | Recombinant Full Length Human MARCKS protein, Flag-tagged | +Inquiry |
MARCKS-1369H | Recombinant Human MARCKS Protein, His (Fc)-Avi-tagged | +Inquiry |
MARCKS-4482H | Recombinant Human MARCKS Protein (Met1-Glu332), N-His tagged | +Inquiry |
◆ Native Proteins | ||
MARCKS-12B | Native Bovine MARCKS protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MARCKS Products
Required fields are marked with *
My Review for All MARCKS Products
Required fields are marked with *