Recombinant Human MARCKS protein, GST-tagged

Cat.No. : MARCKS-17H
Product Overview : Recombinant Human MARCKS(2 a.a. - 65 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 2-65 a.a.
Description : The protein encoded by this gene is a substrate for protein kinase C. It is localized to the plasma membrane and is an actin filament crosslinking protein. Phosphorylation by protein kinase C or binding to calcium-calmodulin inhibits its association with actin and with the plasma membrane, leading to its presence in the cytoplasm. The protein is thought to be involved in cell motility, phagocytosis, membrane trafficking and mitogenesis.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 32.78 kDa
AA Sequence : GAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name MARCKS myristoylated alanine-rich protein kinase C substrate [ Homo sapiens ]
Official Symbol MARCKS
Synonyms MARCKS; myristoylated alanine-rich protein kinase C substrate; MACS, myristoylated alanine rich protein kinase C substrate (MARCKS, 80K L); myristoylated alanine-rich C-kinase substrate; 80K L; PKCSL; phosphomyristin; protein kinase C substrate, 80 kDa protein, light chain; myristoylated alanine-rich protein kinase C substrate (MARCKS, 80K-L); MACS; 80K-L; PRKCSL; FLJ14368; FLJ90045;
Gene ID 4082
mRNA Refseq NM_002356
Protein Refseq NP_002347
MIM 177061
UniProt ID P29966
Chromosome Location 6q21
Pathway Fc gamma R-mediated phagocytosis, organism-specific biosystem; Fc gamma R-mediated phagocytosis, conserved biosystem; Integration of energy metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Regulation of Insulin Secretion, organism-specific biosystem; Regulation of Insulin Secretion by Acetylcholine, organism-specific biosystem;
Function actin filament binding; calmodulin binding; protein kinase C binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MARCKS Products

Required fields are marked with *

My Review for All MARCKS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon