Recombinant Human MARK1 protein, GST-tagged

Cat.No. : MARK1-30185H
Product Overview : Recombinant Human MARK1 (506-611 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Val506-Arg611
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : VCERTTDRYVALQNGKDSSLTEMSVSSISSAGSSVASAVPSARPRHQKSMSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSR
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name MARK1 MAP/microtubule affinity-regulating kinase 1 [ Homo sapiens ]
Official Symbol MARK1
Synonyms MARK1; MAP/microtubule affinity-regulating kinase 1; serine/threonine-protein kinase MARK1; MARK; PAR1 homolog c; Par1c; Par-1c; KIAA1477; MGC126512; MGC126513;
Gene ID 4139
mRNA Refseq NM_018650
Protein Refseq NP_061120
MIM 606511
UniProt ID Q9P0L2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MARK1 Products

Required fields are marked with *

My Review for All MARK1 Products

Required fields are marked with *

0
cart-icon
0
compare icon