Recombinant Human MARK1 protein, GST-tagged
Cat.No. : | MARK1-30185H |
Product Overview : | Recombinant Human MARK1 (506-611 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Val506-Arg611 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | VCERTTDRYVALQNGKDSSLTEMSVSSISSAGSSVASAVPSARPRHQKSMSTSGHPIKVTLPTIKDGSEAYRPGTTQRVPAASPSAHSISTATPDRTRFPRGSSSR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | MARK1 MAP/microtubule affinity-regulating kinase 1 [ Homo sapiens ] |
Official Symbol | MARK1 |
Synonyms | MARK1; MAP/microtubule affinity-regulating kinase 1; serine/threonine-protein kinase MARK1; MARK; PAR1 homolog c; Par1c; Par-1c; KIAA1477; MGC126512; MGC126513; |
Gene ID | 4139 |
mRNA Refseq | NM_018650 |
Protein Refseq | NP_061120 |
MIM | 606511 |
UniProt ID | Q9P0L2 |
◆ Recombinant Proteins | ||
MARK1-1812HF | Active Recombinant Full Length Human MARK1 Protein, GST-tagged | +Inquiry |
MARK1-1197H | Recombinant Human MARK1 Protein (N45-L795), His tagged | +Inquiry |
MARK1-795H | Recombinant Human MARK1 | +Inquiry |
MARK1-6423Z | Recombinant Zebrafish MARK1 | +Inquiry |
MARK1-3244R | Recombinant Rat MARK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MARK1-4465HCL | Recombinant Human MARK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MARK1 Products
Required fields are marked with *
My Review for All MARK1 Products
Required fields are marked with *