Recombinant Human MARK2 protein, His-tagged
| Cat.No. : | MARK2-3525H |
| Product Overview : | Recombinant Human MARK2 protein(10-372 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 10-372 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LNERDTEQPTLGHLDSKPSSKSNMIRGRNSATSADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLLDADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGYKSSELEGDTI |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MARK2 MAP/microtubule affinity-regulating kinase 2 [ Homo sapiens ] |
| Official Symbol | MARK2 |
| Synonyms | MARK2; MAP/microtubule affinity-regulating kinase 2; ELKL motif kinase , EMK1; serine/threonine-protein kinase MARK2; ELKL motif kinase 1; PAR 1; Par1b; protein serine/threonine kinase; Ser/Thr protein kinase PAR 1B; serine/threonine kinase; PAR1 homolog b; Ser/Thr protein kinase PAR-1B; serine/threonine protein kinase EMK; EMK1; EMK-1; PAR-1; Par-1b; MGC99619; |
| Gene ID | 2011 |
| mRNA Refseq | NM_001039469 |
| Protein Refseq | NP_001034558 |
| MIM | 600526 |
| UniProt ID | Q7KZI7 |
| ◆ Recombinant Proteins | ||
| MARK2-3245R | Recombinant Rat MARK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MARK2-3270HF | Active Recombinant Full Length Human MARK2 Protein, GST-tagged | +Inquiry |
| MARK2-125HFL | Active Recombinant Full Length Human MARK2 Protein, N-His-tagged | +Inquiry |
| MARK2-781H | Recombinant Human MARK2 Protein, His-tagged | +Inquiry |
| MARK2-9568M | Recombinant Mouse MARK2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MARK2-1060HCL | Recombinant Human MARK2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MARK2 Products
Required fields are marked with *
My Review for All MARK2 Products
Required fields are marked with *
