Recombinant Human MAST4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MAST4-4360H |
Product Overview : | MAST4 MS Standard C13 and N15-labeled recombinant protein (NP_942123) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the microtubule-associated serine/threonine protein kinases. The proteins in this family contain a domain that gives the kinase the ability to determine its own scaffold to control the effects of their kinase activities. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Molecular Mass : | 25.5 kDa |
AA Sequence : | MGEKVSEAPEPVPRGCSGHGSRTPASALVAASSPGASSAESSSGSETLSEEGEPGGFSREHQPPPPPPLGGTLGARAPAAWAPASVLLERGVLALPPPLPGGAVPPAPRGSSASQEEQDEELDHILSPPPMPFRKCSNPDVASGPGKSLKYKRQLSEDGRQLRRGSLGGALTGRYLLPNPVAGQAWPASAETSNLVRMRSQALGQSAPSLTASLKELSLPRRGSLIDSQKWNCLVKRPVCPNAGRTSPLGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MAST4 microtubule associated serine/threonine kinase family member 4 [ Homo sapiens (human) ] |
Official Symbol | MAST4 |
Synonyms | MAST4; microtubule associated serine/threonine kinase family member 4; microtubule-associated serine/threonine-protein kinase 4; KIAA0303; FLJ16540; FLJ33039; DKFZp686N1467; DKFZp686E18148; |
Gene ID | 375449 |
mRNA Refseq | NM_198828 |
Protein Refseq | NP_942123 |
MIM | 618002 |
UniProt ID | O15021 |
◆ Recombinant Proteins | ||
MAST4-301384H | Recombinant Human MAST4 protein, GST-tagged | +Inquiry |
MAST4-4360H | Recombinant Human MAST4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MAST4-5381M | Recombinant Mouse MAST4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Mast4-3967M | Recombinant Mouse Mast4 Protein, Myc/DDK-tagged | +Inquiry |
MAST4-4385H | Recombinant Human MAST4 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAST4-1009HCL | Recombinant Human MAST4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAST4 Products
Required fields are marked with *
My Review for All MAST4 Products
Required fields are marked with *