"E4" Related Products

Recombinant Human mastadenovirus C E4 protein, T7/His-tagged

Cat.No.: E4-199H
Product Overview: Recombinant adenovirus E4orf1 (128 aa) fused with T7-His-TEV cleavage site Tag at N-terminal and 11R tag at C-terminal was expressed in E. coli.
Source: E. coli
Species: Human mastadenovirus C
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGEFAAAVEALYVVLEREGAILPRQEGFSGVYVFFSPINFVIPPMGAVMLS LRLRVCIPPGYFGRFLALTDVNQPDVFTESYIMTPDMTEELSVVLFNHGDQFFYGHAGMAVVRLMLIRVVFPVVR QASNVLESGGGGSPGRRRRRRRRRRR
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro adenovirus E4ORF1 mediated human endothelial cell differentiation regulation study by intracellular delivery of this protein.2. May be used for mapping E4ORF1 protein-protein interaction.3. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.4. As antigen for specific antibody production.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: E4 control protein E4orf6/7 [ Human adenovirus C ]
Official Symbol: E4
Synonyms: control protein E4orf6/7; control protein E4 34K; control protein E4orf4; control protein E4orf3; control protein E4orf2; control protein E4orf1
Gene ID: 2652989
mRNA Refseq:
Protein Refseq:
MIM:
UniProt ID:

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.