Recombinant Human mastadenovirus C E4 protein, T7/His-tagged
| Cat.No. : | E4-199H |
| Product Overview : | Recombinant adenovirus E4orf1 (128 aa) fused with T7-His-TEV cleavage site Tag at N-terminal and 11R tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human mastadenovirus C |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGEFAAAVEALYVVLEREGAILPRQEGFSGVYVFFSPINFVIPPMGAVMLS LRLRVCIPPGYFGRFLALTDVNQPDVFTESYIMTPDMTEELSVVLFNHGDQFFYGHAGMAVVRLMLIRVVFPVVR QASNVLESGGGGSPGRRRRRRRRRRR |
| Purity : | >90% by SDS-PAGE |
| Applications : | 1. May be used for in vitro adenovirus E4ORF1 mediated human endothelial cell differentiation regulation study by intracellular delivery of this protein.2. May be used for mapping E4ORF1 protein-protein interaction.3. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.4. As antigen for specific antibody production. |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | E4 control protein E4orf6/7 [ Human adenovirus C ] |
| Official Symbol | E4 |
| Synonyms | control protein E4orf6/7; control protein E4 34K; control protein E4orf4; control protein E4orf3; control protein E4orf2; control protein E4orf1 |
| Gene ID | 2652989 |
| mRNA Refseq | |
| Protein Refseq | |
| MIM | |
| UniProt ID |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All E4 Products
Required fields are marked with *
My Review for All E4 Products
Required fields are marked with *
