Recombinant Human mastadenovirus C E4 protein, T7/His-tagged

Cat.No. : E4-199H
Product Overview : Recombinant adenovirus E4orf1 (128 aa) fused with T7-His-TEV cleavage site Tag at N-terminal and 11R tag at C-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human mastadenovirus C
Source : E.coli
Tag : His&T7
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGEFAAAVEALYVVLEREGAILPRQEGFSGVYVFFSPINFVIPPMGAVMLS LRLRVCIPPGYFGRFLALTDVNQPDVFTESYIMTPDMTEELSVVLFNHGDQFFYGHAGMAVVRLMLIRVVFPVVR QASNVLESGGGGSPGRRRRRRRRRRR
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro adenovirus E4ORF1 mediated human endothelial cell differentiation regulation study by intracellular delivery of this protein.2. May be used for mapping E4ORF1 protein-protein interaction.3. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.4. As antigen for specific antibody production.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name E4 control protein E4orf6/7 [ Human adenovirus C ]
Official Symbol E4
Synonyms control protein E4orf6/7; control protein E4 34K; control protein E4orf4; control protein E4orf3; control protein E4orf2; control protein E4orf1
Gene ID 2652989
mRNA Refseq
Protein Refseq
MIM
UniProt ID

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All E4 Products

Required fields are marked with *

My Review for All E4 Products

Required fields are marked with *

0
cart-icon
0
compare icon