Recombinant Human MB Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MB-3090H |
| Product Overview : | MB MS Standard C13 and N15-labeled recombinant protein (NP_976312) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the globin superfamily and is predominantly expressed in skeletal and cardiac muscles. The encoded protein forms a monomeric globular haemoprotein that is primarily responsible for the storage and facilitated transfer of oxygen from the cell membrane to the mitochondria. This protein also plays a role in regulating physiological levels of nitric oxide. Multiple transcript variants encoding distinct isoforms exist for this gene. |
| Molecular Mass : | 17.2 kDa |
| AA Sequence : | MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MB myoglobin [ Homo sapiens (human) ] |
| Official Symbol | MB |
| Synonyms | MB; myoglobin; PVALB; myoglobin |
| Gene ID | 4151 |
| mRNA Refseq | NM_203378 |
| Protein Refseq | NP_976312 |
| MIM | 160000 |
| UniProt ID | P02144 |
| ◆ Recombinant Proteins | ||
| MB-1148H | Recombinant Horse MB Protein, His-tagged | +Inquiry |
| MB-159H | Recombinant Human MB protein | +Inquiry |
| MB-0028H | Recombinant Human MB Protein | +Inquiry |
| Mb-3977M | Recombinant Mouse Mb Protein, Myc/DDK-tagged | +Inquiry |
| MB-10864Z | Recombinant Zebrafish MB | +Inquiry |
| ◆ Native Proteins | ||
| MB-02B | Native Bovine MB Protein | +Inquiry |
| MB-4460H | Native Human Myoglobin | +Inquiry |
| MB-237C | Native Dog Myoglobin | +Inquiry |
| Mb-8232R | Native Rat Myoglobin | +Inquiry |
| Mb-8229M | Native Mouse Myoglobin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MB-4445HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
| MB-4446HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MB Products
Required fields are marked with *
My Review for All MB Products
Required fields are marked with *
