Recombinant Human MBNL1 protein, His/SUMO-tagged
Cat.No. : | MBNL1-6556H |
Product Overview : | Recombinant Human MBNL1 protein (1-382aa), fused to His/SUMO-tag at N-terminus, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 382 |
Description : | Mediates pre-mRNA alternative splicing regulation. Acts either as activator or repressor of splicing on specific pre-mRNA targets. Inhibits cardiac troponin-T (TNNT2) pre-mRNA exon inclusion but induces insulin receptor (IR) pre-mRNA exon inclusion in muscle. Antagonizes the alternative splicing activity pattern of CELF proteins. Regulates the TNNT2 exon 5 skipping through competition with U2AF2. Inhibits the formation of the spliceosome A complex on intron 4 of TNNT2 pre-mRNA. Binds to the stem-loop structure within the polypyrimidine tract of TNNT2 intron 4 during spliceosome assembly. Binds to the 5'-YGCU(U/G)Y-3'consensus sequence. Binds to the IR RNA. Binds to expanded CUG repeat RNA, which folds into a hairpin structure containing GC base pairs and bulged, unpaired U residues. |
Form : | Liquid or Lyophilized powder. If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol; If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 57.0 kDa |
AA Sequence : | MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20 centigrade upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 centigrade/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MBNL1 |
Official Symbol | MBNL1 |
Synonyms | EXP; MBNL |
Gene ID | 4154 |
mRNA Refseq | NM_021038.5 |
Protein Refseq | NP_066368.2 |
MIM | 606516 |
UniProt ID | Q9NR56 |
◆ Recombinant Proteins | ||
MBNL1-3978C | Recombinant Chicken MBNL1 | +Inquiry |
MBNL1-524H | Recombinant Human MBNL1 protein, MYC/DDK-tagged | +Inquiry |
MBNL1-301HF | Recombinant Full Length Human MBNL1 Protein | +Inquiry |
MBNL1-2738H | Recombinant Human MBNL1, MYC/DDK-tagged | +Inquiry |
MBNL1-30258TH | Recombinant Human MBNL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBNL1-4441HCL | Recombinant Human MBNL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBNL1 Products
Required fields are marked with *
My Review for All MBNL1 Products
Required fields are marked with *
0
Inquiry Basket