Recombinant Human MBNL3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MBNL3-5211H |
| Product Overview : | MBNL3 MS Standard C13 and N15-labeled recombinant protein (NP_597846) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the muscleblind-like family of proteins. The encoded protein may function in regulation of alternative splicing and may play a role in the pathophysiology of myotonic dystrophy. Alternatively spliced transcript variants have been described. |
| Molecular Mass : | 36.2 kDa |
| AA Sequence : | MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGRVVACFDSLKGRCTRENCKYLHPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIPHPGMGLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGATPTTVSAATTPATSVPFAAPTTGNQIPQLSIDELNSSMFVSQMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MBNL3 muscleblind-like splicing regulator 3 [ Homo sapiens (human) ] |
| Official Symbol | MBNL3 |
| Synonyms | MBNL3; muscleblind-like splicing regulator 3; muscleblind like 3 (Drosophila); muscleblind-like protein 3; CHCR; FLJ11316; MBLX39; MBXL; muscleblind-like 3; Cys3His CCG1-required protein; muscleblind-like X-linked protein; MBLX; FLJ97142; |
| Gene ID | 55796 |
| mRNA Refseq | NM_133486 |
| Protein Refseq | NP_597846 |
| MIM | 300413 |
| UniProt ID | Q9NUK0 |
| ◆ Recombinant Proteins | ||
| MBNL3-6276Z | Recombinant Zebrafish MBNL3 | +Inquiry |
| MBNL3-5406H | Recombinant Human MBNL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Mbnl3-3983M | Recombinant Mouse Mbnl3 Protein, Myc/DDK-tagged | +Inquiry |
| MBNL3-1945C | Recombinant Chicken MBNL3 | +Inquiry |
| MBNL3-3982C | Recombinant Chicken MBNL3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MBNL3-1067HCL | Recombinant Human MBNL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBNL3 Products
Required fields are marked with *
My Review for All MBNL3 Products
Required fields are marked with *



