Recombinant Human MBOAT7 protein, His-tagged

Cat.No. : MBOAT7-3901H
Product Overview : Recombinant Human MBOAT7 protein(284-344 aa), fused to His tag, was expressed in E. coli.
Availability July 04, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 284-344 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : SSPEKAASLEYDYETIRNIDCYSTDFCVRVRDGMRYWNMTVQWWLAQYIYKSAPARSYVLR
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name MBOAT7 membrane bound O-acyltransferase domain containing 7 [ Homo sapiens ]
Official Symbol MBOAT7
Synonyms MBOAT7; membrane bound O-acyltransferase domain containing 7; LENG4, leukocyte receptor cluster (LRC) member 4; lysophospholipid acyltransferase 7; BB1; hMBOA 7; LPIAT; lysophosphatidylinositol acyltransferase; LPLAT 7; h-mboa-7; lyso-PI acyltransferase; leukocyte receptor cluster member 4; leukocyte receptor cluster (LRC) member 4; O-acyltransferase domain-containing protein 7; 1-acylglycerophosphatidylinositol O-acyltransferase; bladder and breast carcinoma-overexpressed gene 1 protein; membrane-bound O-acyltransferase domain-containing protein 7; malignant cell expression-enhanced gene/tumor progression-enhanced; LRC4; LENG4; MBOA7; OACT7; hMBOA-7; FLJ41296;
Gene ID 79143
mRNA Refseq NM_001146056
Protein Refseq NP_001139528
MIM 606048
UniProt ID Q96N66

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MBOAT7 Products

Required fields are marked with *

My Review for All MBOAT7 Products

Required fields are marked with *

0
cart-icon