Recombinant Human MBOAT7 protein, His-tagged
| Cat.No. : | MBOAT7-3901H |
| Product Overview : | Recombinant Human MBOAT7 protein(284-344 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 16, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 284-344 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SSPEKAASLEYDYETIRNIDCYSTDFCVRVRDGMRYWNMTVQWWLAQYIYKSAPARSYVLR |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MBOAT7 membrane bound O-acyltransferase domain containing 7 [ Homo sapiens ] |
| Official Symbol | MBOAT7 |
| Synonyms | MBOAT7; membrane bound O-acyltransferase domain containing 7; LENG4, leukocyte receptor cluster (LRC) member 4; lysophospholipid acyltransferase 7; BB1; hMBOA 7; LPIAT; lysophosphatidylinositol acyltransferase; LPLAT 7; h-mboa-7; lyso-PI acyltransferase; leukocyte receptor cluster member 4; leukocyte receptor cluster (LRC) member 4; O-acyltransferase domain-containing protein 7; 1-acylglycerophosphatidylinositol O-acyltransferase; bladder and breast carcinoma-overexpressed gene 1 protein; membrane-bound O-acyltransferase domain-containing protein 7; malignant cell expression-enhanced gene/tumor progression-enhanced; LRC4; LENG4; MBOA7; OACT7; hMBOA-7; FLJ41296; |
| Gene ID | 79143 |
| mRNA Refseq | NM_001146056 |
| Protein Refseq | NP_001139528 |
| MIM | 606048 |
| UniProt ID | Q96N66 |
| ◆ Recombinant Proteins | ||
| MBOAT7-9612M | Recombinant Mouse MBOAT7 Protein | +Inquiry |
| MBOAT7-10822Z | Recombinant Zebrafish MBOAT7 | +Inquiry |
| Mboat7-3984M | Recombinant Mouse Mboat7 Protein, Myc/DDK-tagged | +Inquiry |
| MBOAT7-5398M | Recombinant Mouse MBOAT7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MBOAT7-2027HFL | Recombinant Full Length Human MBOAT7 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBOAT7 Products
Required fields are marked with *
My Review for All MBOAT7 Products
Required fields are marked with *
