Recombinant Full Length Human Lysophospholipid Acyltransferase 7(Mboat7) Protein, His-Tagged
Cat.No. : | RFL16917HF |
Product Overview : | Recombinant Full Length Human Lysophospholipid acyltransferase 7(MBOAT7) Protein (Q96N66) (1-472aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-472) |
Form : | Lyophilized powder |
AA Sequence : | MSPEEWTYLVVLLISIPIGFLFKKAGPGLKRWGAAAVGLGLTLFTCGPHTLHSLVTILGT WALIQAQPCSCHALALAWTFSYLLFFRALSLLGLPTPTPFTNAVQLLLTLKLVSLASEVQ DLHLAQRKEMASGFSKGPTLGLLPDVPSLMETLSYSYCYVGIMTGPFFRYRTYLDWLEQP FPGAVPSLRPLLRRAWPAPLFGLLFLLSSHLFPLEAVREDAFYARPLPARLFYMIPVFFA FRMRFYVAWIAAECGCIAAGFGAYPVAAKARAGGGPTLQCPPPSSPEKAASLEYDYETIR NIDCYSTDFCVRVRDGMRYWNMTVQWWLAQYIYKSAPARSYVLRSAWTMLLSAYWHGLHP GYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHWFLKMRAYDYMCMGFVLLSLA DTLRYWASIYFCIHFLALAALGLGLALGGGSPSRRKAASQPTSLAPEKLREE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MBOAT7 |
Synonyms | MBOAT7; BB1; LENG4; OACT7; Lysophospholipid acyltransferase 7; LPLAT 7; 1-acylglycerophosphatidylinositol O-acyltransferase; Bladder and breast carcinoma-overexpressed gene 1 protein; Leukocyte receptor cluster member 4; Lysophosphatidylinositol acyltrans |
UniProt ID | Q96N66 |
◆ Recombinant Proteins | ||
Mboat7-3984M | Recombinant Mouse Mboat7 Protein, Myc/DDK-tagged | +Inquiry |
MBOAT7-10822Z | Recombinant Zebrafish MBOAT7 | +Inquiry |
RFL16917HF | Recombinant Full Length Human Lysophospholipid Acyltransferase 7(Mboat7) Protein, His-Tagged | +Inquiry |
MBOAT7-9612M | Recombinant Mouse MBOAT7 Protein | +Inquiry |
MBOAT7-1378H | Recombinant Human MBOAT7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBOAT7 Products
Required fields are marked with *
My Review for All MBOAT7 Products
Required fields are marked with *
0
Inquiry Basket