"MBTPS1" Related Products

Expand

Recombinant Human MBTPS1 protein, GST-tagged

Cat.No.: MBTPS1-28H
Product Overview: Recombinant Human MBTPS1(246 a.a. - 355 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the cis/medial-Golgi where a second autocatalytic event takes place and the catalytic activity is acquired. It encodes a type 1 membrane bound protease which is ubiquitously expressed and regulates cholesterol or lipid homeostasis via cleavage of substrates at non-basic residues. Mutations in this gene may be associated with lysosomal dysfunction.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 37.84 kDa
AA Sequence: GLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYTSWFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVD KVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDV
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: MBTPS1 membrane-bound transcription factor peptidase, site 1 [ Homo sapiens ]
Official Symbol: MBTPS1
Synonyms: MBTPS1; membrane-bound transcription factor peptidase, site 1; membrane bound transcription factor protease, site 1; membrane-bound transcription factor site-1 protease; KIAA0091; PCSK8; S1P; SKI 1; site-1 protease; endopeptidase S1P; subtilisin/kexin isozyme-1; subtilisin/kexin-isozyme 1; membrane-bound transcription factor protease, site 1; SKI-1; MGC138711; MGC138712;
Gene ID: 8720
mRNA Refseq: NM_003791
Protein Refseq: NP_003782
MIM: 603355
UniProt ID: Q14703
Chromosome Location: 16q24
Pathway: Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem; Unfolded Protein Response, organism-specific biosystem;
Function: peptidase activity; serine-type endopeptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.