Recombinant Human MBTPS1 protein, GST-tagged
Cat.No. : | MBTPS1-29H |
Product Overview : | Recombinant Human MBTPS1(1 a.a. - 552 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-552 a.a. |
Description : | This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the cis/medial-Golgi where a second autocatalytic event takes place and the catalytic activity is acquired. It encodes a type 1 membrane bound protease which is ubiquitously expressed and regulates cholesterol or lipid homeostasis via cleavage of substrates at non-basic residues. Mutations in this gene may be associated with lysosomal dysfunction. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 87.7 kDa |
AA Sequence : | MKLVNIWLLLLVVLLCGKKHLGDRLEKKSFEKAPCPGCSHLTLKVEFSSTVVEYEYIVAFNGYFTAKARNSFISS ALKSSEVDNWRIIPRNNPSSDYPSDFEVIQIKEKQKAGLLTLEDHPNIKRVTPQRKVFRSLKYAESDPTVPCNET RWSQKWQSSRPLRRASLSLGSGFWHATGRHSSRRLLRAIPRQVAQTLQADVLWQMGYTGANVRVAVFDTGLSEKH PHFKNVKERTNWTNERTLDDGLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYASWFLDAFNYAILKK IDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDVIGVGGIDFEDNIARFSSRGM TTWELPGGYGRMKPDIVTYGAGVRGSGVKGGCRALSGTSVASPVVAGAVTLLVSTVQKRELVNPASMKQALIASA RRLPGVNMFEQGHGKLDLLRAYQILNSYKPQASLSPSYIDLTECPYMWPYCSQPIYYGGMPTVVNVTILNGMGVT GRIVDKPDWQPYLPQNGDNIEVAFSYS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | MBTPS1 membrane-bound transcription factor peptidase, site 1 [ Homo sapiens ] |
Official Symbol | MBTPS1 |
Synonyms | MBTPS1; membrane-bound transcription factor peptidase, site 1; membrane bound transcription factor protease, site 1; membrane-bound transcription factor site-1 protease; KIAA0091; PCSK8; S1P; SKI 1; site-1 protease; endopeptidase S1P; subtilisin/kexin isozyme-1; subtilisin/kexin-isozyme 1; membrane-bound transcription factor protease, site 1; SKI-1; MGC138711; MGC138712; |
Gene ID | 8720 |
mRNA Refseq | NM_003791 |
Protein Refseq | NP_003782 |
MIM | 603355 |
UniProt ID | Q14703 |
Chromosome Location | 16q24 |
Pathway | Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem; Unfolded Protein Response, organism-specific biosystem; |
Function | peptidase activity; serine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
MBTPS1-138H | Recombinant Human MBTPS1, His-tagged | +Inquiry |
MBTPS1-5400M | Recombinant Mouse MBTPS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MBTPS1-9614M | Recombinant Mouse MBTPS1 Protein | +Inquiry |
MBTPS1-2960H | Recombinant Human MBTPS1 protein, His-tagged | +Inquiry |
MBTPS1-3608R | Recombinant Rat MBTPS1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBTPS1-4435HCL | Recombinant Human MBTPS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MBTPS1 Products
Required fields are marked with *
My Review for All MBTPS1 Products
Required fields are marked with *
0
Inquiry Basket