Recombinant Human MBTPS1 protein, GST-tagged

Cat.No. : MBTPS1-29H
Product Overview : Recombinant Human MBTPS1(1 a.a. - 552 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-552 a.a.
Description : This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the cis/medial-Golgi where a second autocatalytic event takes place and the catalytic activity is acquired. It encodes a type 1 membrane bound protease which is ubiquitously expressed and regulates cholesterol or lipid homeostasis via cleavage of substrates at non-basic residues. Mutations in this gene may be associated with lysosomal dysfunction.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 87.7 kDa
AA Sequence : MKLVNIWLLLLVVLLCGKKHLGDRLEKKSFEKAPCPGCSHLTLKVEFSSTVVEYEYIVAFNGYFTAKARNSFISS ALKSSEVDNWRIIPRNNPSSDYPSDFEVIQIKEKQKAGLLTLEDHPNIKRVTPQRKVFRSLKYAESDPTVPCNET RWSQKWQSSRPLRRASLSLGSGFWHATGRHSSRRLLRAIPRQVAQTLQADVLWQMGYTGANVRVAVFDTGLSEKH PHFKNVKERTNWTNERTLDDGLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYASWFLDAFNYAILKK IDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDVIGVGGIDFEDNIARFSSRGM TTWELPGGYGRMKPDIVTYGAGVRGSGVKGGCRALSGTSVASPVVAGAVTLLVSTVQKRELVNPASMKQALIASA RRLPGVNMFEQGHGKLDLLRAYQILNSYKPQASLSPSYIDLTECPYMWPYCSQPIYYGGMPTVVNVTILNGMGVT GRIVDKPDWQPYLPQNGDNIEVAFSYS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name MBTPS1 membrane-bound transcription factor peptidase, site 1 [ Homo sapiens ]
Official Symbol MBTPS1
Synonyms MBTPS1; membrane-bound transcription factor peptidase, site 1; membrane bound transcription factor protease, site 1; membrane-bound transcription factor site-1 protease; KIAA0091; PCSK8; S1P; SKI 1; site-1 protease; endopeptidase S1P; subtilisin/kexin isozyme-1; subtilisin/kexin-isozyme 1; membrane-bound transcription factor protease, site 1; SKI-1; MGC138711; MGC138712;
Gene ID 8720
mRNA Refseq NM_003791
Protein Refseq NP_003782
MIM 603355
UniProt ID Q14703
Chromosome Location 16q24
Pathway Activation of Chaperones by ATF6-alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem; Unfolded Protein Response, organism-specific biosystem;
Function peptidase activity; serine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MBTPS1 Products

Required fields are marked with *

My Review for All MBTPS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon