Recombinant Human MC4R
Cat.No. : | MC4R-29453TH |
Product Overview : | Recombinant fragment corresponding to amino acids 1-43 of Human MC4 Receptor with a proprietary tag; Predicted MWt 30.36 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 43 amino acids |
Description : | The protein encoded by this gene is a membrane-bound receptor and member of the melanocortin receptor family. The encoded protein interacts with adrenocorticotropic and MSH hormones and is mediated by G proteins. This is an intronless gene. Defects in this gene are a cause of autosomal dominant obesity. |
Molecular Weight : | 30.360kDa inclusive of tags |
Tissue specificity : | Brain, placental, and gut tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQ |
Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. |
Gene Name | MC4R melanocortin 4 receptor [ Homo sapiens ] |
Official Symbol | MC4R |
Synonyms | MC4R; melanocortin 4 receptor; melanocortin receptor 4; |
Gene ID | 4160 |
mRNA Refseq | NM_005912 |
Protein Refseq | NP_005903 |
MIM | 155541 |
Uniprot ID | P32245 |
Chromosome Location | 18q22 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem; |
Function | G-protein coupled receptor activity; melanocortin receptor activity; melanocyte-stimulating hormone receptor activity; neuropeptide binding; peptide hormone binding; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MC4R Products
Required fields are marked with *
My Review for All MC4R Products
Required fields are marked with *
0
Inquiry Basket