Recombinant Human MC4R

Cat.No. : MC4R-29453TH
Product Overview : Recombinant fragment corresponding to amino acids 1-43 of Human MC4 Receptor with a proprietary tag; Predicted MWt 30.36 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 43 amino acids
Description : The protein encoded by this gene is a membrane-bound receptor and member of the melanocortin receptor family. The encoded protein interacts with adrenocorticotropic and MSH hormones and is mediated by G proteins. This is an intronless gene. Defects in this gene are a cause of autosomal dominant obesity.
Molecular Weight : 30.360kDa inclusive of tags
Tissue specificity : Brain, placental, and gut tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQ
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name MC4R melanocortin 4 receptor [ Homo sapiens ]
Official Symbol MC4R
Synonyms MC4R; melanocortin 4 receptor; melanocortin receptor 4;
Gene ID 4160
mRNA Refseq NM_005912
Protein Refseq NP_005903
MIM 155541
Uniprot ID P32245
Chromosome Location 18q22
Pathway Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem;
Function G-protein coupled receptor activity; melanocortin receptor activity; melanocyte-stimulating hormone receptor activity; neuropeptide binding; peptide hormone binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MC4R Products

Required fields are marked with *

My Review for All MC4R Products

Required fields are marked with *

0

Inquiry Basket

cartIcon