Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human MC4R

Cat.No. : MC4R-29453TH
Product Overview : Recombinant fragment corresponding to amino acids 1-43 of Human MC4 Receptor with a proprietary tag; Predicted MWt 30.36 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is a membrane-bound receptor and member of the melanocortin receptor family. The encoded protein interacts with adrenocorticotropic and MSH hormones and is mediated by G proteins. This is an intronless gene. Defects in this gene are a cause of autosomal dominant obesity.
Protein length : 43 amino acids
Molecular Weight : 30.360kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Brain, placental, and gut tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQ
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name : MC4R melanocortin 4 receptor [ Homo sapiens ]
Official Symbol : MC4R
Synonyms : MC4R; melanocortin 4 receptor; melanocortin receptor 4;
Gene ID : 4160
mRNA Refseq : NM_005912
Protein Refseq : NP_005903
MIM : 155541
Uniprot ID : P32245
Chromosome Location : 18q22
Pathway : Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem;
Function : G-protein coupled receptor activity; melanocortin receptor activity; melanocyte-stimulating hormone receptor activity; neuropeptide binding; peptide hormone binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends