Recombinant Human MC4R Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MC4R-522H |
Product Overview : | MC4R MS Standard C13 and N15-labeled recombinant protein (NP_005903) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a membrane-bound receptor and member of the melanocortin receptor family. The encoded protein interacts with adrenocorticotropic and MSH hormones and is mediated by G proteins. This is an intronless gene. Defects in this gene are a cause of autosomal dominant obesity. |
Molecular Mass : | 36.8 kDa |
AA Sequence : | MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVNIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVKRVGIIISCIWAACTVSGILFIIYSDSSAVIICLITMFFTMLALMASLYVHMFLMARLHIKRIAVLPGTGAIRQGANMKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSIIDPLIYALRSQELRKTFKEIICCYPLGGLCDLSSRYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MC4R melanocortin 4 receptor [ Homo sapiens (human) ] |
Official Symbol | MC4R |
Synonyms | MC4R; melanocortin 4 receptor; melanocortin receptor 4; MC4-R; MGC126851; MGC138197; |
Gene ID | 4160 |
mRNA Refseq | NM_005912 |
Protein Refseq | NP_005903 |
MIM | 155541 |
UniProt ID | P32245 |
◆ Recombinant Proteins | ||
RFL9956RF | Recombinant Full Length Rat Melanocortin Receptor 4(Mc4R) Protein, His-Tagged | +Inquiry |
MC4R-1129HFL | Recombinant Human MC4R protein, His&Flag-tagged | +Inquiry |
MC4R-305H | Active Recombinant Human MC4R Full Length Transmembrane protein(Nanodisc) | +Inquiry |
MC4R-29453TH | Recombinant Human MC4R | +Inquiry |
RFL2456VF | Recombinant Full Length Vulpes Vulpes Melanocortin Receptor 4(Mc4R) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MC4R Products
Required fields are marked with *
My Review for All MC4R Products
Required fields are marked with *
0
Inquiry Basket