Recombinant Human MCCD1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MCCD1-1978H |
| Product Overview : | MCCD1 MS Standard C13 and N15-labeled recombinant protein (NP_001011700) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | MCCD1 (Mitochondrial Coiled-Coil Domain 1) is a Protein Coding gene. |
| Molecular Mass : | 13.3 kDa |
| AA Sequence : | MVLPLPWLSRYHFLRLLLPSWSLAPQGSHGCCSQNPKASMEEQTNSRGNGKMTSPPRGPGTHRTAELARAEELLEQQLELYQALLEGQEGAWEAQALVLKIQKLKEQMRRHQESLGGGATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MCCD1 mitochondrial coiled-coil domain 1 [ Homo sapiens (human) ] |
| Official Symbol | MCCD1 |
| Synonyms | MCCD1; mitochondrial coiled-coil domain 1; mitochondrial coiled-coil domain protein 1 |
| Gene ID | 401250 |
| mRNA Refseq | NM_001011700 |
| Protein Refseq | NP_001011700 |
| MIM | 609624 |
| UniProt ID | P59942 |
| ◆ Recombinant Proteins | ||
| MCCD1-2519R | Recombinant Rhesus Macaque MCCD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MCCD1-945H | Recombinant Human MCCD1 | +Inquiry |
| MCCD1-2699R | Recombinant Rhesus monkey MCCD1 Protein, His-tagged | +Inquiry |
| MCCD1-3446H | Recombinant Human MCCD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MCCD1-1978H | Recombinant Human MCCD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MCCD1-4427HCL | Recombinant Human MCCD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCCD1 Products
Required fields are marked with *
My Review for All MCCD1 Products
Required fields are marked with *
