Recombinant Human MCEE, His-tagged
Cat.No. : | MCEE-29452TH |
Product Overview : | Recombinant full length Human MCEE with an N terminal His tag; 161 amino acids with a predicted MWt 17.3kDa including tag,. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 140 amino acids |
Description : | The product of this gene catalyzes the interconversion of D- and L-methylmalonyl-CoA during the degradation of branched chain amino acids. odd chain-length fatty acids, and other metabolites. Mutations in this gene result in methylmalonyl-CoA epimerase deficiency, which is presented as mild to moderate methylmalonic aciduria. |
Conjugation : | HIS |
Molecular Weight : | 17.300kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMQVTGSVWNLGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA |
Sequence Similarities : | Belongs to the glyoxalase I family. |
Gene Name | MCEE methylmalonyl CoA epimerase [ Homo sapiens ] |
Official Symbol | MCEE |
Synonyms | MCEE; methylmalonyl CoA epimerase; methylmalonyl-CoA epimerase, mitochondrial; GLOD2; glyoxalase domain containing 2; |
Gene ID | 84693 |
mRNA Refseq | NM_032601 |
Protein Refseq | NP_115990 |
MIM | 608419 |
Uniprot ID | Q96PE7 |
Chromosome Location | 2p13.3 |
Pathway | 2-oxobutanoate degradation I, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Glyoxylate and dicarboxylate metabolism, organism-specific biosystem; Glyoxylate and dicarboxylate metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function | isomerase activity; methylmalonyl-CoA epimerase activity; |
◆ Recombinant Proteins | ||
Mcee-1735R | Recombinant Rat Mcee protein, His & T7-tagged | +Inquiry |
MCEE-9626M | Recombinant Mouse MCEE Protein | +Inquiry |
MCEE-5551C | Recombinant Chicken MCEE | +Inquiry |
MCEE-5550C | Recombinant Chicken MCEE | +Inquiry |
MCEE-5210H | Recombinant Human MCEE Protein (Gln37-Ala176), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCEE-4426HCL | Recombinant Human MCEE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCEE Products
Required fields are marked with *
My Review for All MCEE Products
Required fields are marked with *