Recombinant Human MCEE, His-tagged
| Cat.No. : | MCEE-29452TH |
| Product Overview : | Recombinant full length Human MCEE with an N terminal His tag; 161 amino acids with a predicted MWt 17.3kDa including tag,. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 140 amino acids |
| Description : | The product of this gene catalyzes the interconversion of D- and L-methylmalonyl-CoA during the degradation of branched chain amino acids. odd chain-length fatty acids, and other metabolites. Mutations in this gene result in methylmalonyl-CoA epimerase deficiency, which is presented as mild to moderate methylmalonic aciduria. |
| Conjugation : | HIS |
| Molecular Weight : | 17.300kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMQVTGSVWNLGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA |
| Sequence Similarities : | Belongs to the glyoxalase I family. |
| Gene Name | MCEE methylmalonyl CoA epimerase [ Homo sapiens ] |
| Official Symbol | MCEE |
| Synonyms | MCEE; methylmalonyl CoA epimerase; methylmalonyl-CoA epimerase, mitochondrial; GLOD2; glyoxalase domain containing 2; |
| Gene ID | 84693 |
| mRNA Refseq | NM_032601 |
| Protein Refseq | NP_115990 |
| MIM | 608419 |
| Uniprot ID | Q96PE7 |
| Chromosome Location | 2p13.3 |
| Pathway | 2-oxobutanoate degradation I, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Glyoxylate and dicarboxylate metabolism, organism-specific biosystem; Glyoxylate and dicarboxylate metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
| Function | isomerase activity; methylmalonyl-CoA epimerase activity; |
| ◆ Recombinant Proteins | ||
| MCEE-9626M | Recombinant Mouse MCEE Protein | +Inquiry |
| MCEE-29452TH | Recombinant Human MCEE, His-tagged | +Inquiry |
| MCEE-2906Z | Recombinant Zebrafish MCEE | +Inquiry |
| MCEE-5551C | Recombinant Chicken MCEE | +Inquiry |
| Mcee-1735R | Recombinant Rat Mcee protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MCEE-4426HCL | Recombinant Human MCEE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCEE Products
Required fields are marked with *
My Review for All MCEE Products
Required fields are marked with *
