Recombinant Human MCEE, His-tagged

• Cat.No.: MCEE-29452TH
• Product Overview: Recombinant full length Human MCEE with an N terminal His tag; 161 amino acids with a predicted MWt 17.3kDa including tag,.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 140 amino acids
• Description: The product of this gene catalyzes the interconversion of D- and L-methylmalonyl-CoA during the degradation of branched chain amino acids. odd chain-length fatty acids, and other metabolites. Mutations in this gene result in methylmalonyl-CoA epimerase deficiency, which is presented as mild to moderate methylmalonic aciduria.
• Conjugation: HIS
• Molecular Weight: 17.300kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMQVTGSVWNLGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA
• Sequence Similarities: Belongs to the glyoxalase I family.

Gene Information

• Gene Name: MCEE methylmalonyl CoA epimerase [ Homo sapiens ]
• Official Symbol: MCEE
• Synonyms: MCEE; methylmalonyl CoA epimerase; methylmalonyl-CoA epimerase, mitochondrial; GLOD2; glyoxalase domain containing 2
• Gene ID: 84693
• mRNA Refseq: NM_032601
• Protein Refseq: NP_115990
• MIM: 608419
• Uniprot ID: Q96PE7
• Chromosome Location: 2p13.3
• Pathway: 2-oxobutanoate degradation I, organism-specific biosystem; Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Glyoxylate and dicarboxylate metabolism, organism-specific biosystem; Glyoxylate and dicarboxylate metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem
• Function: isomerase activity; methylmalonyl-CoA epimerase activity