Recombinant Human MCEE protein, GST-tagged
| Cat.No. : | MCEE-4543H |
| Product Overview : | Recombinant Human MCEE protein(1-176 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 1-176 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MARVLKAAAANAVGLFSRLQAPIPTVRASSTSQPLDQVTGSVWNLGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGLDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | MCEE methylmalonyl CoA epimerase [ Homo sapiens ] |
| Official Symbol | MCEE |
| Synonyms | MCEE; methylmalonyl CoA epimerase; methylmalonyl-CoA epimerase, mitochondrial; GLOD2; glyoxalase domain containing 2; DL-methylmalonyl-CoA racemase; |
| mRNA Refseq | NM_032601 |
| Protein Refseq | NP_115990 |
| MIM | 608419 |
| UniProt ID | Q96PE7 |
| Gene ID | 84693 |
| ◆ Recombinant Proteins | ||
| MCEE-5210H | Recombinant Human MCEE Protein (Gln37-Ala176), C-His tagged | +Inquiry |
| MCEE-5551C | Recombinant Chicken MCEE | +Inquiry |
| MCEE-5406M | Recombinant Mouse MCEE Protein, His (Fc)-Avi-tagged | +Inquiry |
| Mcee-1735R | Recombinant Rat Mcee protein, His & T7-tagged | +Inquiry |
| MCEE-5211H | Recombinant Human MCEE Protein (Gln37-Ala176), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MCEE-4426HCL | Recombinant Human MCEE 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCEE Products
Required fields are marked with *
My Review for All MCEE Products
Required fields are marked with *
