Recombinant Human MCM4, His-tagged
Cat.No. : | MCM4-28040TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 545-863 of Human MCM4 with N terminal His tag; 319 amino acids, 37kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 545-863 a.a. |
Description : | The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. This gene is mapped to a region on the chromosome 8 head-to-head next to the PRKDC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks. Alternatively spliced transcript variants encoding the same protein have been reported. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 87 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTR SVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIES QWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAHSTIMP RLSEEASQALIEAYVDMRKIGSSRGMVSAYPRQLESLI RLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRT GIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTP ALKYQQLFEDIRGQSDIAITKDMFEEALRALADDDFLT VTGKTVRLL |
Sequence Similarities : | Belongs to the MCM family.Contains 1 MCM domain. |
Gene Name | MCM4 minichromosome maintenance complex component 4 [ Homo sapiens ] |
Official Symbol | MCM4 |
Synonyms | MCM4; minichromosome maintenance complex component 4; CDC21, MCM4 minichromosome maintenance deficient 4 (S. cerevisiae); DNA replication licensing factor MCM4; CDC54; hCdc21; MGC33310; P1 Cdc21; |
Gene ID | 4173 |
mRNA Refseq | NM_005914 |
Protein Refseq | NP_005905 |
MIM | 602638 |
Uniprot ID | P33991 |
Chromosome Location | 8q12-q13 |
Pathway | Activation of ATR in response to replication stress, organism-specific biosystem; Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the pre-replicative complex, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Cell Cycle Checkpoints, organism-specific biosystem; |
Function | ATP binding; contributes_to ATP-dependent DNA helicase activity; DNA binding; helicase activity; hydrolase activity; |
◆ Recombinant Proteins | ||
MCM4-5413M | Recombinant Mouse MCM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
MCM4-2704R | Recombinant Rhesus monkey MCM4 Protein, His-tagged | +Inquiry |
MCM4-1876H | Recombinant Human MCM4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MCM4-2524R | Recombinant Rhesus Macaque MCM4 Protein, His (Fc)-Avi-tagged | +Inquiry |
MCM4-3275H | Recombinant Human MCM4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCM4-4418HCL | Recombinant Human MCM4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCM4 Products
Required fields are marked with *
My Review for All MCM4 Products
Required fields are marked with *
0
Inquiry Basket