Recombinant Human MCM9 Protein, GST-tagged

Cat.No. : MCM9-4514H
Product Overview : Human MCMDC1 partial ORF ( AAH31658, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication. [provided by RefSeq
Molecular Mass : 36.41 kDa
AA Sequence : MNSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETNMEIGEYFNMFPSEVLTIFDSALRRSALTILQSLSQPEAVSMKQNLHARI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MCM9 minichromosome maintenance complex component 9 [ Homo sapiens ]
Official Symbol MCM9
Synonyms MCM9; minichromosome maintenance complex component 9; C6orf61, chromosome 6 open reading frame 61 , MCMDC1, minichromosome maintenance deficient domain containing 1; DNA replication licensing factor MCM9; dJ329L24.3; FLJ20170; MGC35304; minichromosome maintenance deficient domain containing 1; mini-chromosome maintenance deficient domain-containing protein 1; MCMDC1; C6orf61; dJ329L24.1; FLJ13942; FLJ56845;
Gene ID 254394
mRNA Refseq NM_017696
Protein Refseq NP_060166
MIM 610098
UniProt ID Q9NXL9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MCM9 Products

Required fields are marked with *

My Review for All MCM9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon