Recombinant Human MCM9 Protein, GST-tagged
| Cat.No. : | MCM9-4514H |
| Product Overview : | Human MCMDC1 partial ORF ( AAH31658, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein that shares similarity with minichromosome maintenance (MCM) proteins, which are known to be essential for initiation of DNA replication. [provided by RefSeq |
| Molecular Mass : | 36.41 kDa |
| AA Sequence : | MNSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETNMEIGEYFNMFPSEVLTIFDSALRRSALTILQSLSQPEAVSMKQNLHARI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MCM9 minichromosome maintenance complex component 9 [ Homo sapiens ] |
| Official Symbol | MCM9 |
| Synonyms | MCM9; minichromosome maintenance complex component 9; C6orf61, chromosome 6 open reading frame 61 , MCMDC1, minichromosome maintenance deficient domain containing 1; DNA replication licensing factor MCM9; dJ329L24.3; FLJ20170; MGC35304; minichromosome maintenance deficient domain containing 1; mini-chromosome maintenance deficient domain-containing protein 1; MCMDC1; C6orf61; dJ329L24.1; FLJ13942; FLJ56845; |
| Gene ID | 254394 |
| mRNA Refseq | NM_017696 |
| Protein Refseq | NP_060166 |
| MIM | 610098 |
| UniProt ID | Q9NXL9 |
| ◆ Recombinant Proteins | ||
| MCM9-4514H | Recombinant Human MCM9 Protein, GST-tagged | +Inquiry |
| MCM9-5922H | Recombinant Human MCM9 protein(1-391aa), His-tagged | +Inquiry |
| MCM9-5416M | Recombinant Mouse MCM9 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MCM9-783H | Recombinant Human MCM9, GST-tagged | +Inquiry |
| MCM9-9642M | Recombinant Mouse MCM9 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCM9 Products
Required fields are marked with *
My Review for All MCM9 Products
Required fields are marked with *
