Recombinant Human MCTS1 Protein, GST-tagged

Cat.No. : MCTS1-4506H
Product Overview : Human MCTS1 full-length ORF ( AAH01013, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MCTS1 (MCTS1, Re-Initiation And Release Factor) is a Protein Coding gene. GO annotations related to this gene include RNA binding and translation initiation factor activity.
Molecular Mass : 45.65 kDa
AA Sequence : MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MCTS1 malignant T cell amplified sequence 1 [ Homo sapiens ]
Official Symbol MCTS1
Synonyms MCTS1; malignant T cell amplified sequence 1; malignant T-cell-amplified sequence 1; MCT 1; multiple copies T-cell malignancies; malignant T cell-amplified sequence 1; MCT1; MCT-1; FLJ39637;
Gene ID 28985
mRNA Refseq NM_001137554
Protein Refseq NP_001131026
MIM 300587
UniProt ID Q9ULC4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MCTS1 Products

Required fields are marked with *

My Review for All MCTS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon