Recombinant Human MCTS1 Protein, GST-tagged
| Cat.No. : | MCTS1-4506H |
| Product Overview : | Human MCTS1 full-length ORF ( AAH01013, 1 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | MCTS1 (MCTS1, Re-Initiation And Release Factor) is a Protein Coding gene. GO annotations related to this gene include RNA binding and translation initiation factor activity. |
| Molecular Mass : | 45.65 kDa |
| AA Sequence : | MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MCTS1 malignant T cell amplified sequence 1 [ Homo sapiens ] |
| Official Symbol | MCTS1 |
| Synonyms | MCTS1; malignant T cell amplified sequence 1; malignant T-cell-amplified sequence 1; MCT 1; multiple copies T-cell malignancies; malignant T cell-amplified sequence 1; MCT1; MCT-1; FLJ39637; |
| Gene ID | 28985 |
| mRNA Refseq | NM_001137554 |
| Protein Refseq | NP_001131026 |
| MIM | 300587 |
| UniProt ID | Q9ULC4 |
| ◆ Recombinant Proteins | ||
| MCTS1-9655M | Recombinant Mouse MCTS1 Protein | +Inquiry |
| MCTS1-11297Z | Recombinant Zebrafish MCTS1 | +Inquiry |
| MCTS1-7551H | Recombinant Human MCTS1, His-tagged | +Inquiry |
| MCTS1-6097HF | Recombinant Full Length Human MCTS1 Protein, GST-tagged | +Inquiry |
| MCTS1-4951H | Recombinant Human MCTS1 protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MCTS1-4410HCL | Recombinant Human MCTS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCTS1 Products
Required fields are marked with *
My Review for All MCTS1 Products
Required fields are marked with *
