Recombinant Human MCTS1 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | MCTS1-280H |
Product Overview : | MCTS1 MS Standard C13 and N15-labeled recombinant protein (NP_054779) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Anti-oncogene that plays a role in cell cycle regulation; decreases cell doubling time and anchorage-dependent growth; shortens the duration of G1 transit time and G1/S transition. When constitutively expressed, increases CDK4 and CDK6 kinases activity and CCND1/cyclin D1 protein level, as well as G1 cyclin/CDK complex formation. Involved in translation initiation; promotes recruitment of aminoacetyled initiator tRNA to P site of 40S ribosomes. Can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits. Plays a role as translation enhancer; recruits the density-regulated protein/DENR and binds to the cap complex of the 5'-terminus of mRNAs, subsequently altering the mRNA translation profile; up-regulates protein levels of BCL2L2, TFDP1, MRE11, CCND1 and E2F1, while mRNA levels remains constant. Hyperactivates DNA damage signaling pathway; increased gamma-irradiation-induced phosphorylation of histone H2AX, and induces damage foci formation. Increases the overall number of chromosomal abnormalities such as larger chromosomes formation and multiples chromosomal fusions when overexpressed in gamma-irradiated cells. May play a role in promoting lymphoid tumor development: lymphoid cell lines overexpressing MCTS1 exhibit increased growth rates and display increased protection against apoptosis. May contribute to the pathogenesis and progression of breast cancer via promotion of angiogenesis through the decline of inhibitory THBS1/thrombospondin-1, and inhibition of apoptosis. Involved in the process of proteasome degradation to down-regulate Tumor suppressor p53/TP53 in breast cancer cell; Positively regulates phosphorylation of MAPK1 and MAPK3. Involved in translation initiation; promotes aminoacetyled initiator tRNA to P site of 40S ribosomes. Can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits. |
Molecular Mass : | 20.6 kDa |
AA Sequence : | MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MCTS1 malignant T cell amplified sequence 1 [ Homo sapiens (human) ] |
Official Symbol | MCTS1 |
Synonyms | MCTS1; malignant T cell amplified sequence 1; malignant T-cell-amplified sequence 1; MCT 1; multiple copies T-cell malignancies; malignant T cell-amplified sequence 1; MCT1; MCT-1; FLJ39637; |
Gene ID | 28985 |
mRNA Refseq | NM_014060 |
Protein Refseq | NP_054779 |
MIM | 300587 |
UniProt ID | Q9ULC4 |
◆ Recombinant Proteins | ||
MCTS1-9655M | Recombinant Mouse MCTS1 Protein | +Inquiry |
MCTS1-3755C | Recombinant Chicken MCTS1 | +Inquiry |
MCTS1-6097HF | Recombinant Full Length Human MCTS1 Protein, GST-tagged | +Inquiry |
MCTS1-3625R | Recombinant Rat MCTS1 Protein | +Inquiry |
MCTS1-280H | Recombinant Human MCTS1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCTS1-4410HCL | Recombinant Human MCTS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MCTS1 Products
Required fields are marked with *
My Review for All MCTS1 Products
Required fields are marked with *
0
Inquiry Basket