Recombinant Human MDFI Protein, GST-tagged
Cat.No. : | MDFI-4504H |
Product Overview : | Human MDFI full-length ORF ( NP_005577.1, 1 a.a. - 246 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This protein is a transcription factor that negatively regulates other myogenic family proteins. Studies of the mouse homolog, I-mf, show that it interferes with myogenic factor function by masking nuclear localization signals and preventing DNA binding. Knockout mouse studies show defects in the formation of vertebrae and ribs that also involve cartilage formation in these structures. [provided by RefSeq |
Molecular Mass : | 51.4 kDa |
AA Sequence : | MYQVSGQRPSGCDAPYGAPSAAPGPAQTLSLLPGLEVVTGSTHPAEAAPEEGSLEEAATPMPQGNGPGIPQGLDSTDLDVPTEAVTCQPQGNPLGCTPLLPNDSGHPSELGGTRRAGNGALGGPKAHRKLQTHPSLASQGSKKSKSSSKSTTSQIPLQAQEDCCVHCILSCLFCEFLTLCNIVLDCATCGSCSSEDSCLCCCCCGSGECADCDLPCDLDCGILDACCESADCLEICMECCGLCFSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MDFI MyoD family inhibitor [ Homo sapiens ] |
Official Symbol | MDFI |
Synonyms | MDFI; MyoD family inhibitor; myoD family inhibitor; I mfa; inhibitor of MyoD family a; myogenic repressor I-mf; I-MF; I-mfa; |
Gene ID | 4188 |
mRNA Refseq | NM_005586 |
Protein Refseq | NP_005577 |
MIM | 604971 |
UniProt ID | Q99750 |
◆ Recombinant Proteins | ||
MDFI-4504H | Recombinant Human MDFI Protein, GST-tagged | +Inquiry |
MDFI-2530R | Recombinant Rhesus Macaque MDFI Protein, His (Fc)-Avi-tagged | +Inquiry |
MDFI-5427M | Recombinant Mouse MDFI Protein, His (Fc)-Avi-tagged | +Inquiry |
MDFI-2710R | Recombinant Rhesus monkey MDFI Protein, His-tagged | +Inquiry |
MDFI-6101HF | Recombinant Full Length Human MDFI Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MDFI Products
Required fields are marked with *
My Review for All MDFI Products
Required fields are marked with *
0
Inquiry Basket