Recombinant Human MDK Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MDK-5931H |
| Product Overview : | MDK MS Standard C13 and N15-labeled recombinant protein (NP_001012333) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed. |
| Molecular Mass : | 15.6 kDa |
| AA Sequence : | MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MDK midkine [ Homo sapiens (human) ] |
| Official Symbol | MDK |
| Synonyms | MDK; midkine (neurite growth-promoting factor 2); NEGF2; midkine; FLJ27379; MK; ARAP; amphiregulin-associated protein; midgestation and kidney protein; neurite outgrowth-promoting protein; neurite outgrowth-promoting factor 2; |
| Gene ID | 4192 |
| mRNA Refseq | NM_001012333 |
| Protein Refseq | NP_001012333 |
| MIM | 162096 |
| UniProt ID | P21741 |
| ◆ Recombinant Proteins | ||
| Mdk-0485M | Recombinant Mouse Mdk protein, His-Avi-tagged, Biotinylated | +Inquiry |
| MDK-6917H | Recombinant Human Midkine (neurite growth-promoting factor 2), His-tagged | +Inquiry |
| MDK-6105HF | Recombinant Full Length Human MDK Protein, GST-tagged | +Inquiry |
| MDK-668H | Recombinant Human MDK Protein, MYC/DDK-tagged | +Inquiry |
| MDK-4526H | Recombinant Human MDK Protein (Ala22-Asp143), His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MDK-568HCL | Recombinant Human MDK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MDK Products
Required fields are marked with *
My Review for All MDK Products
Required fields are marked with *
