Recombinant Human MDM2 Protein, His tagged

• Cat.No.: MDM2-2732H
• Product Overview: Recombinant Human MDM2 Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes a nuclear-localized E3 ubiquitin ligase. The encoded protein can promote tumor formation by targeting tumor suppressor proteins, such as p53, for proteasomal degradation. This gene is itself transcriptionally-regulated by p53. Overexpression or amplification of this locus is detected in a variety of different cancers. There is a pseudogene for this gene on chromosome 2. Alternative splicing results in a multitude of transcript variants, many of which may be expressed only in tumor cells.
• Molecular Mass: 14 kDa
• AASequence: MHHHHHHHHENLYFQSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGTSVSEN
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 2.1 mg/mL by BCA
• Storage Buffer: Sterile 50mM Tris, 300mM NaCl, pH8.0

Gene Information

• Gene Name: MDM2 MDM2 proto-oncogene [ Homo sapiens (human) ]
• Official Symbol: MDM2
• Synonyms: MDM2; MDM2 proto-oncogene; HDMX; LSKB; hdm2; ACTFS; E3 ubiquitin-protein ligase Mdm2; MDM2 oncogene, E3 ubiquitin protein ligase; MDM2 proto-oncogene, E3 ubiquitin protein ligase; Mdm2, p53 E3 ubiquitin protein ligase homolog; Mdm2, transformed 3T3 cell double minute 2, p53 binding protein; double minute 2, human homolog of; p53-binding protein; oncoprotein Mdm2; EC 2.3.2.27
• Gene ID: 4193
• mRNA Refseq: NM_002392
• Protein Refseq: NP_002383
• MIM: 164785
• UniProt ID: A8WFP2