Species : |
Human |
Source : |
Wheat Germ |
Tag : |
Non |
Protein Length : |
110 amino acids |
Description : |
This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latters degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. |
Molecular Weight : |
37.730kDa inclusive of tags |
Tissue specificity : |
Expressed in all tissues tested with high levels in thymus. |
Form : |
Liquid |
Purity : |
Proprietary Purification |
Storage buffer : |
pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : |
ENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQ RTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTC FHCARRLKKAGASCPICKKEIQLVIKVFIA |
Sequence Similarities : |
Belongs to the MDM2/MDM4 family.Contains 1 RanBP2-type zinc finger.Contains 1 RING-type zinc finger.Contains 1 SWIB domain. |