Recombinant Human MDP1 Protein, GST-tagged
Cat.No. : | MDP1-5296H |
Product Overview : | Human MGC5987 full-length ORF ( NP_612485.2, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MDP1 (Magnesium Dependent Phosphatase 1) is a Protein Coding gene. GO annotations related to this gene include phosphatase activity and protein tyrosine phosphatase activity. An important paralog of this gene is NEDD8-MDP1. |
Molecular Mass : | 46.5 kDa |
AA Sequence : | MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MDP1 magnesium dependent phosphatase 1 [ Homo sapiens (human) ] |
Official Symbol | MDP1 |
Synonyms | MDP1; magnesium dependent phosphatase 1; MDP-1; FN6PASE; magnesium-dependent phosphatase 1; fructosamine-6-phosphatase; EC 3.1.3.48 |
Gene ID | 145553 |
mRNA Refseq | NM_001199821 |
Protein Refseq | NP_001186750 |
UniProt ID | Q86V88 |
◆ Recombinant Proteins | ||
MDP1-9670M | Recombinant Mouse MDP1 Protein | +Inquiry |
MDP1-6434HF | Recombinant Full Length Human MDP1 Protein, GST-tagged | +Inquiry |
MDP1-944H | Recombinant Human Magnesium-Dependent Phosphatase 1, His-tagged | +Inquiry |
MDP1-5434M | Recombinant Mouse MDP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Mdp1-4006M | Recombinant Mouse Mdp1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MDP1-4402HCL | Recombinant Human MDP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MDP1 Products
Required fields are marked with *
My Review for All MDP1 Products
Required fields are marked with *