Recombinant Human MDP1 Protein, GST-tagged

Cat.No. : MDP1-5296H
Product Overview : Human MGC5987 full-length ORF ( NP_612485.2, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MDP1 (Magnesium Dependent Phosphatase 1) is a Protein Coding gene. GO annotations related to this gene include phosphatase activity and protein tyrosine phosphatase activity. An important paralog of this gene is NEDD8-MDP1.
Molecular Mass : 46.5 kDa
AA Sequence : MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MDP1 magnesium dependent phosphatase 1 [ Homo sapiens (human) ]
Official Symbol MDP1
Synonyms MDP1; magnesium dependent phosphatase 1; MDP-1; FN6PASE; magnesium-dependent phosphatase 1; fructosamine-6-phosphatase; EC 3.1.3.48
Gene ID 145553
mRNA Refseq NM_001199821
Protein Refseq NP_001186750
UniProt ID Q86V88

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MDP1 Products

Required fields are marked with *

My Review for All MDP1 Products

Required fields are marked with *

0
cart-icon