Recombinant Human MDP1, His-tagged

Cat.No. : MDP1-27383TH
Product Overview : Recombinant full length Human MDP1 with an N terminal His tag ; predicted MWt: 22.7 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 176 amino acids
Description : MDP1 (Magnesium-dependent phosphatase 1) belongs to the HAD-like hydrolase superfamily. This protein is a magnesium-dependent phosphatase which may act as a tyrosine phosphatase. It is inhibited by vanadate and zinc, and slightly by calcium.
Conjugation : HIS
Molecular Weight : 22.700kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSHMARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA
Gene Name MDP1 magnesium-dependent phosphatase 1 [ Homo sapiens ]
Official Symbol MDP1
Synonyms MDP1; magnesium-dependent phosphatase 1; FN6Pase; fructosamine 6 phosphatase; MGC5987;
Gene ID 145553
mRNA Refseq NM_001199822
Protein Refseq NP_001186751
Uniprot ID Q86V88
Chromosome Location 14q12
Function hydrolase activity; metal ion binding; protein tyrosine phosphatase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MDP1 Products

Required fields are marked with *

My Review for All MDP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon