Recombinant Human MDP1, His-tagged

• Cat.No.: MDP1-27383TH
• Product Overview: Recombinant full length Human MDP1 with an N terminal His tag ; predicted MWt: 22.7 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 176 amino acids
• Description: MDP1 (Magnesium-dependent phosphatase 1) belongs to the HAD-like hydrolase superfamily. This protein is a magnesium-dependent phosphatase which may act as a tyrosine phosphatase. It is inhibited by vanadate and zinc, and slightly by calcium.
• Conjugation: HIS
• Molecular Weight: 22.700kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA

Gene Information

• Gene Name: MDP1 magnesium-dependent phosphatase 1 [ Homo sapiens ]
• Official Symbol: MDP1
• Synonyms: MDP1; magnesium-dependent phosphatase 1; FN6Pase; fructosamine 6 phosphatase; MGC5987
• Gene ID: 145553
• mRNA Refseq: NM_001199822
• Protein Refseq: NP_001186751
• Uniprot ID: Q86V88
• Chromosome Location: 14q12
• Function: hydrolase activity; metal ion binding; protein tyrosine phosphatase activity