Recombinant Human MDP1, His-tagged
Cat.No. : | MDP1-27383TH |
Product Overview : | Recombinant full length Human MDP1 with an N terminal His tag ; predicted MWt: 22.7 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 176 amino acids |
Description : | MDP1 (Magnesium-dependent phosphatase 1) belongs to the HAD-like hydrolase superfamily. This protein is a magnesium-dependent phosphatase which may act as a tyrosine phosphatase. It is inhibited by vanadate and zinc, and slightly by calcium. |
Conjugation : | HIS |
Molecular Weight : | 22.700kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA |
Gene Name | MDP1 magnesium-dependent phosphatase 1 [ Homo sapiens ] |
Official Symbol | MDP1 |
Synonyms | MDP1; magnesium-dependent phosphatase 1; FN6Pase; fructosamine 6 phosphatase; MGC5987; |
Gene ID | 145553 |
mRNA Refseq | NM_001199822 |
Protein Refseq | NP_001186751 |
Uniprot ID | Q86V88 |
Chromosome Location | 14q12 |
Function | hydrolase activity; metal ion binding; protein tyrosine phosphatase activity; |
◆ Recombinant Proteins | ||
MDP1-944H | Recombinant Human Magnesium-Dependent Phosphatase 1, His-tagged | +Inquiry |
MDP1-5296H | Recombinant Human MDP1 Protein, GST-tagged | +Inquiry |
MDP1-5434M | Recombinant Mouse MDP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MDP1-9670M | Recombinant Mouse MDP1 Protein | +Inquiry |
MDP1-6434HF | Recombinant Full Length Human MDP1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MDP1-4402HCL | Recombinant Human MDP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MDP1 Products
Required fields are marked with *
My Review for All MDP1 Products
Required fields are marked with *
0
Inquiry Basket