Recombinant Human ME1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ME1-5947H |
Product Overview : | ME1 MS Standard C13 and N15-labeled recombinant protein (NP_002386) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet. |
Molecular Mass : | 64.1 kDa |
AA Sequence : | MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ME1 malic enzyme 1 [ Homo sapiens (human) ] |
Official Symbol | ME1 |
Synonyms | ME1; malic enzyme 1, NADP(+)-dependent, cytosolic; NADP-dependent malic enzyme; NADP-ME; malate dehydrogenase; malic enzyme 1, soluble; Malic enzyme, cytoplasmic; pyruvic-malic carboxylase; MES; HUMNDME; |
Gene ID | 4199 |
mRNA Refseq | NM_002395 |
Protein Refseq | NP_002386 |
MIM | 154250 |
UniProt ID | P48163 |
◆ Recombinant Proteins | ||
ME1-9671M | Recombinant Mouse ME1 Protein | +Inquiry |
ME1-5435M | Recombinant Mouse ME1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ME1-1387H | Recombinant Human ME1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Me1-4007M | Recombinant Mouse Me1 Protein, Myc/DDK-tagged | +Inquiry |
ME1-5947H | Recombinant Human ME1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ME1-4401HCL | Recombinant Human ME1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ME1 Products
Required fields are marked with *
My Review for All ME1 Products
Required fields are marked with *
0
Inquiry Basket