Recombinant Human ME2 protein, His-tagged
Cat.No. : | ME2-2864H |
Product Overview : | Recombinant Human ME2 protein(136-480 aa), fused to His tag, was expressed in E. coli. |
Availability | August 26, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 136-480 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | ISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGYRIPIC |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ME2 malic enzyme 2, NAD(+)-dependent, mitochondrial [ Homo sapiens ] |
Official Symbol | ME2 |
Synonyms | ME2; malic enzyme 2, NAD(+)-dependent, mitochondrial; NAD-dependent malic enzyme, mitochondrial; NAD-ME; malate dehydrogenase; pyruvic-malic carboxylase; ODS1; |
Gene ID | 4200 |
mRNA Refseq | NM_001168335 |
Protein Refseq | NP_001161807 |
MIM | 154270 |
UniProt ID | P23368 |
◆ Recombinant Proteins | ||
ME2-9672M | Recombinant Mouse ME2 Protein | +Inquiry |
ME2-4488H | Recombinant Human ME2 Protein, GST-tagged | +Inquiry |
ME2-1052Z | Recombinant Zebrafish ME2 | +Inquiry |
ME2-1274H | Recombinant Human ME2 protein | +Inquiry |
ME2-644H | Recombinant Human ME2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ME2-4400HCL | Recombinant Human ME2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ME2 Products
Required fields are marked with *
My Review for All ME2 Products
Required fields are marked with *