Recombinant Human MECP2 protein, His-tagged
Cat.No. : | MECP2-3721H |
Product Overview : | Recombinant Human MECP2 protein(1-218 aa), fused to His tag, was expressed in E. coli. |
Availability | July 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-218 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MECP2 methyl CpG binding protein 2 (Rett syndrome) [ Homo sapiens ] |
Official Symbol | MECP2 |
Synonyms | MECP2; methyl CpG binding protein 2 (Rett syndrome); mental retardation, X linked 16 , mental retardation, X linked 79 , MRX16, MRX79, RTT; methyl-CpG-binding protein 2; meCp-2 protein; RS; RTS; RTT; PPMX; MRX16; MRX79; MRXSL; AUTSX3; MRXS13; DKFZp686A24160; |
Gene ID | 4204 |
mRNA Refseq | NM_001110792 |
Protein Refseq | NP_001104262 |
MIM | 300005 |
UniProt ID | P51608 |
◆ Recombinant Proteins | ||
MECP2-66H | Recombinant Human MECP2 protein, His-tagged | +Inquiry |
MECP2-29556TH | Recombinant Human MECP2 | +Inquiry |
MECP2-4530H | Recombinant Human MECP2 Protein (Met1-Ser486), C-His tagged | +Inquiry |
MECP2-3633R | Recombinant Rat MECP2 Protein | +Inquiry |
MECP2-4531H | Recombinant Human MECP2 Protein (Met1-Lys177), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MECP2-4395HCL | Recombinant Human MECP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MECP2 Products
Required fields are marked with *
My Review for All MECP2 Products
Required fields are marked with *