Recombinant Human MECP2 protein, His-tagged
| Cat.No. : | MECP2-3721H |
| Product Overview : | Recombinant Human MECP2 protein(1-218 aa), fused to His tag, was expressed in E. coli. |
| Availability | February 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-218 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPG |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MECP2 methyl CpG binding protein 2 (Rett syndrome) [ Homo sapiens ] |
| Official Symbol | MECP2 |
| Synonyms | MECP2; methyl CpG binding protein 2 (Rett syndrome); mental retardation, X linked 16 , mental retardation, X linked 79 , MRX16, MRX79, RTT; methyl-CpG-binding protein 2; meCp-2 protein; RS; RTS; RTT; PPMX; MRX16; MRX79; MRXSL; AUTSX3; MRXS13; DKFZp686A24160; |
| Gene ID | 4204 |
| mRNA Refseq | NM_001110792 |
| Protein Refseq | NP_001104262 |
| MIM | 300005 |
| UniProt ID | P51608 |
| ◆ Recombinant Proteins | ||
| MECP2-682C | Recombinant Cynomolgus MECP2 Protein, His-tagged | +Inquiry |
| MECP2-2534R | Recombinant Rhesus Macaque MECP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MECP2-1549H | Recombinant Human MECP2 Protein, His-tagged | +Inquiry |
| MECP2-5439M | Recombinant Mouse MECP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MECP2-273H | Recombinant Human MECP2, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MECP2-4395HCL | Recombinant Human MECP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MECP2 Products
Required fields are marked with *
My Review for All MECP2 Products
Required fields are marked with *
