Recombinant Human MECR Protein, GST-tagged
| Cat.No. : | MECR-4482H |
| Product Overview : | Human MECR full-length ORF ( NP_057095.2, 1 a.a. - 373 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is an oxidoreductase that catalyzes the last step in mitochondrial fatty acid synthesis. Defects in this gene are a cause of childhood-onset dystonia and optic atrophy. [provided by RefSeq, Mar 2017] |
| Molecular Mass : | 66.9 kDa |
| AA Sequence : | MWVCSTLWRVRTPARQWRGLLPASGCHGPAASSYSASAEPARVRALVYGHHGDPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MECR mitochondrial trans-2-enoyl-CoA reductase [ Homo sapiens ] |
| Official Symbol | MECR |
| Synonyms | MECR; mitochondrial trans-2-enoyl-CoA reductase; trans-2-enoyl-CoA reductase, mitochondrial; CGI 63; FASN2B; mitochondrial 2 enoyl thioester reductase; NRBF1; nuclear receptor binding factor 1; NRBF-1; hsNrbf-1; nuclear receptor-binding factor 1; mitochondrial 2-enoyl thioester reductase; homolog of yeast 2-enoyl thioester reductase; CGI-63; |
| Gene ID | 51102 |
| mRNA Refseq | NM_001024732 |
| Protein Refseq | NP_001019903 |
| MIM | 608205 |
| UniProt ID | Q9BV79 |
| ◆ Recombinant Proteins | ||
| MECR-2530H | Recombinant Human MECR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MECR-3290R | Recombinant Rat MECR Protein, His (Fc)-Avi-tagged | +Inquiry |
| MECR-2715R | Recombinant Rhesus monkey MECR Protein, His-tagged | +Inquiry |
| MECR-728H | Recombinant Human MECR, His-tagged | +Inquiry |
| MECR-6129HF | Recombinant Full Length Human MECR Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MECR-4394HCL | Recombinant Human MECR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MECR Products
Required fields are marked with *
My Review for All MECR Products
Required fields are marked with *
