Recombinant Human MED17 Protein, GST-tagged

Cat.No. : MED17-1907H
Product Overview : Human CRSP6 partial ORF ( AAH21101, 551 a.a. - 651 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.85 kDa
AA Sequence : FSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRGPFKEVQWNKMEGRNFVYKMELLMSALSPCLL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MED17 mediator complex subunit 17 [ Homo sapiens ]
Official Symbol MED17
Synonyms MED17; mediator complex subunit 17; cofactor required for Sp1 transcriptional activation, subunit 6 (77kD) , cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa , CRSP6; mediator of RNA polymerase II transcription subunit 17; CRSP77; DRIP80; TRAP80; ARC77; CRSP complex subunit 6; transcriptional coactivator CRSP77; activator-recruited cofactor 77 kDa component; vitamin D3 receptor-interacting protein complex 80 kDa component; thyroid hormone receptor-associated protein complex 80 kDa component; cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa; CRSP6; FLJ10812;
Gene ID 9440
mRNA Refseq NM_004268
Protein Refseq NP_004259
MIM 603810
UniProt ID Q9NVC6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MED17 Products

Required fields are marked with *

My Review for All MED17 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon