Recombinant Human MED17 Protein, GST-tagged

• Cat.No.: MED17-1907H
• Product Overview: Human CRSP6 partial ORF ( AAH21101, 551 a.a. - 651 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.85 kDa
• AA Sequence: FSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRGPFKEVQWNKMEGRNFVYKMELLMSALSPCLL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MED17 mediator complex subunit 17 [ Homo sapiens ]
• Official Symbol: MED17
• Synonyms: MED17; mediator complex subunit 17; cofactor required for Sp1 transcriptional activation, subunit 6 (77kD) , cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa , CRSP6; mediator of RNA polymerase II transcription subunit 17; CRSP77; DRIP80; TRAP80; ARC77; CRSP complex subunit 6; transcriptional coactivator CRSP77; activator-recruited cofactor 77 kDa component; vitamin D3 receptor-interacting protein complex 80 kDa component; thyroid hormone receptor-associated protein complex 80 kDa component; cofactor required for Sp1 transcriptional activation, subunit 6, 77kDa; CRSP6; FLJ10812
• Gene ID: 9440
• mRNA Refseq: NM_004268
• Protein Refseq: NP_004259
• MIM: 603810
• UniProt ID: Q9NVC6